SecReT4
Protein ID: 154253863
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3427
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3664398..3664844 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDA7HYP7
KEGG IDpla:Plav_3427
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 6.2e-41, Aligned region: 35..145
Protein Sequence: 148 a.a.     [Download]
>gi|154253863|ref|YP_001414687.1| hypothetical protein Plav_3427 [Parvibaculum lavamentivorans DS-1]
MPASFPRSAPSWRALGLAVVLPVSLGVFSPATFAADVLVITDSRHPVKTMGGERLIELDEAYRIEAELSA
ELPAEPEQATALVKRRLNSGGTDLQRRIASAYQGVADAWSLGITSIPAVVVDQRYVVYGEPDVARAVARI
EQHRRAQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3664398-3664844 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGCCAGCATCTTTTCCCAGGTCCGCTCCAAGCTGGCGAGCCCTTGGCCTGGCCGTTGTACTGCCGGTGT
CCTTGGGTGTCTTCAGTCCGGCCACATTCGCTGCCGATGTGCTGGTCATCACCGACAGCCGCCATCCGGT
CAAGACCATGGGCGGCGAGCGGCTGATCGAGCTGGACGAAGCGTACCGGATTGAAGCGGAGCTTTCTGCG
GAACTGCCCGCCGAACCCGAACAGGCGACCGCCCTCGTCAAGCGTCGGCTGAACAGCGGCGGCACCGACC
TCCAACGCCGCATCGCTTCCGCCTACCAGGGCGTTGCCGACGCATGGAGCCTGGGCATCACCAGCATCCC
GGCCGTCGTGGTGGATCAACGCTACGTCGTCTATGGCGAACCCGATGTGGCCCGCGCTGTCGCGCGCATC
GAGCAGCACCGGAGGGCCCAGCCGTGA
 Primer design