SecReT4
Protein ID: 154253864
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3428
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3664841..3665788 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDA7HYP8
KEGG IDpla:Plav_3428
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.6e-93, Aligned region: 33..303
Protein Sequence: 315 a.a.     [Download]
>gi|154253864|ref|YP_001414688.1| hypothetical protein Plav_3428 [Parvibaculum lavamentivorans DS-1]
MTRPFDLMRRLRAGVASVLLLSATGSYALNTATIVGSVASPDCLEYRVVGICYWLYCTWTGCTVRTSVKV
RHYIPDAVVSSYSNTGENPWAEVRAMSTPNPSAQAGGDGTTNEDHENNLAKFKNADVIGHPGVEVFNQFV
SSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEALIPGTREIGVRSTLNLWGNVYPRGGFLHQTD
DHKAGAVVAQRAGDVVTRRGQLHVYQPLLANARDGYWPAGELVEGDASTGKWQELTPVLSSSCSVFPRNG
SLTQAQQGDYAWALWRPYACCERRGQVFLGSVDFL
 
Nucleotide Sequence: 948 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3664841-3665788 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
GTGACCCGCCCATTCGACCTGATGCGCCGCTTGCGTGCTGGCGTGGCATCCGTGCTGCTGCTCAGCGCCA
CGGGCAGCTATGCGCTCAACACCGCAACCATCGTCGGCTCGGTGGCATCGCCAGACTGCCTCGAATACCG
CGTCGTCGGGATCTGCTACTGGCTGTACTGCACCTGGACCGGCTGCACGGTGCGCACGTCGGTCAAAGTG
CGCCACTACATCCCGGATGCGGTCGTCTCCAGCTACAGCAATACCGGAGAAAACCCCTGGGCCGAGGTTC
GGGCGATGAGCACGCCCAATCCTTCAGCTCAGGCCGGTGGTGACGGCACCACCAACGAAGACCACGAGAA
CAACCTCGCCAAATTCAAGAACGCGGATGTCATCGGGCATCCCGGCGTCGAGGTATTCAACCAGTTCGTC
TCCTCATCGGGCTACTTCTGCGAGGGCGCGGGCACGGCGTTCATGCCGTATCTGCTCAGCACCTTGGACA
CGCTGGCCTGGCGCTACAACGTGCCCGAGATGGCCTACCCGGAGGCACTGATCCCCGGGACGCGCGAGAT
CGGCGTGCGCTCGACGTTGAACCTCTGGGGCAACGTGTATCCGCGCGGCGGCTTCCTGCATCAGACAGAC
GACCACAAGGCTGGTGCCGTGGTGGCCCAGCGTGCGGGCGATGTCGTCACTCGCCGCGGGCAGTTGCACG
TGTACCAGCCGCTGCTCGCCAACGCCCGTGATGGCTACTGGCCGGCTGGCGAGCTGGTCGAAGGCGACGC
CTCGACGGGCAAGTGGCAGGAACTCACACCCGTCCTGTCATCGTCATGCTCGGTCTTCCCGCGCAACGGC
TCCCTGACACAGGCCCAGCAAGGCGATTACGCGTGGGCGCTGTGGCGGCCCTATGCGTGCTGTGAACGCC
GTGGGCAGGTGTTTCTTGGCAGCGTTGATTTCCTCTGA
 Primer design