SecReT4
Protein ID: 154253865
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3429
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3665798..3667192 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA7HYP9
KEGG IDpla:Plav_3429
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|154253865|ref|YP_001414689.1| hypothetical protein Plav_3429 [Parvibaculum lavamentivorans DS-1]
MKRPEPTNLSTRAYRLLRPTALAGALALGCGLAWAQAGYQNSGPVVGDDVMYSIGGGSAVSMGRAAGMRS
IGVGVGWNSNLICGDMSLQTTLRNQLNGITNGFQQIMGNVIQSATSAVASLPALIIQRADPGLYNLLTNG
VLQARLDFDRSKLTCRAMAEKMAEMAGGQLGWSQMAEGMALRDAVSSTDAVSAIEQAETRRGNDGVPWVG
GSNAGGAGQPAIRVVGDVTRAGYNLVNGRGVTDTSSIASASCVSLSCQTWTSPQQAIEWATRVLGEQEQR
TCDACTKTETVPGVGLTPLIQEEYEVKLETLQELISGTRNTTFENLREAGSTSLPITRGVIEALRDEPDQ
DLLARRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANQLAVEAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGVYEGDPVPDRLDQLQKGNPGGRP
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3665798-3667192 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAAGCGTCCTGAACCGACGAATCTCTCCACCAGGGCGTACCGCCTGCTGCGTCCGACGGCACTGGCCG
GCGCGCTCGCCCTGGGCTGCGGCCTGGCATGGGCACAGGCCGGATACCAGAACAGCGGCCCCGTCGTCGG
CGATGACGTCATGTACTCGATCGGCGGCGGCAGCGCAGTGTCCATGGGCCGCGCCGCCGGCATGCGTTCG
ATCGGGGTCGGCGTGGGGTGGAACAGCAACCTGATCTGCGGTGACATGAGCCTTCAGACCACCCTGCGCA
ATCAGCTCAATGGCATCACGAATGGTTTCCAGCAGATCATGGGTAACGTGATCCAGAGCGCCACGAGTGC
CGTGGCATCCCTGCCGGCGCTGATCATCCAACGCGCCGATCCCGGTTTGTACAACTTGCTCACGAATGGC
GTGCTGCAAGCGCGGCTGGATTTCGACCGTTCCAAGCTGACGTGCCGCGCCATGGCCGAGAAGATGGCCG
AGATGGCGGGCGGCCAGCTTGGCTGGAGCCAGATGGCCGAAGGCATGGCGCTGCGCGATGCGGTGTCGAG
CACGGACGCCGTGTCGGCCATCGAGCAGGCCGAGACGCGCCGGGGCAATGATGGCGTGCCCTGGGTGGGC
GGCAGCAATGCCGGTGGCGCAGGCCAGCCGGCTATTCGGGTGGTCGGCGATGTCACTCGCGCGGGCTACA
ACCTGGTCAACGGCCGTGGCGTGACCGACACGTCATCCATCGCATCAGCCAGTTGCGTGAGCCTGTCGTG
CCAGACCTGGACCTCGCCGCAGCAGGCGATCGAATGGGCCACACGGGTCCTCGGGGAGCAGGAGCAGCGC
ACCTGCGATGCCTGCACCAAGACCGAGACGGTGCCCGGCGTCGGACTGACGCCGCTGATCCAGGAAGAAT
ACGAGGTGAAGCTGGAAACCTTGCAGGAGCTGATCTCGGGGACGCGCAACACGACCTTCGAGAACCTGCG
CGAGGCCGGCAGCACGTCGCTGCCGATCACGCGCGGCGTGATCGAGGCACTGCGCGACGAGCCGGACCAG
GACCTGCTCGCGCGACGCCTAGCGTCCGAGGTCGCGCTCTCGTCGGTGCTGGAGAAAGCATTGCTGCTCC
AGCGGACCCTGCTGACGGGCAAGAAGGAACCCAACGTGGCGGCCAACCAGTTGGCGGTCGAGGCGGTGAA
CCACGAGAGCGACACGCTCGACCGCGAGATCCGCAACCTCAAGACCGAGCTGGAGCTGCGCCGCGAGCTG
GCCAACAACTCGCCGATGGCCATCATCCAGCGCCACGGTACGCGCGCGGCGGGTTCGCGCGGCGTCTATG
AGGGGGACCCGGTGCCCGACCGCCTCGACCAGTTGCAGAAGGGCAACCCGGGAGGCCGGCCATGA
 Primer design