SecReT4
Protein ID: 154253867
T4SS name [ID]Tfc [711]
Gene symbol-
Locus tagPlav_3431
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3667564..3669087 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA7HYQ1
KEGG IDpla:Plav_3431
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.8e-130, Aligned region: 10..492
Protein Sequence: 507 a.a.     [Download]
>gi|154253867|ref|YP_001414691.1| hypothetical protein Plav_3431 [Parvibaculum lavamentivorans DS-1]
MTLFTTDYLEYYLTLVSWIVHNGIWAVLVSSGVFALPFVAIIVQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLNTIQYDSSRSAQCQVSVPQPTGTGWSQSFSTLNNQSAKLPVWWAFMHALS
RAVTGASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVADFTHDCYGPARAKLFMQRPNLDEAQMHDVTW
IGSRFFTDTAGYYDNYRSSTPRDDWPYDSDRDAGLAQVSSGGGYPTCRQWWADGSNGLRARLLGQVDPNL
LTRVAGWAGFLSRAEVDDSVIRTIASPRQQKLNQGSVYTDYGGQIDKTLPNVITRAAGDVGMAVGGIAAF
PAMDVVRQALPMVLALLKMALVICIPLVLVIGTYDLKTVVTVSVVQFALFFVDFWFQLARWIDSTILDAL
YGWGWGWNRPHNNFDPLVGLNNAFGDMLLNFVMGTMFIVMPTFWVMALAWAGVRAGNVLQGLAGATGDAK
AAGGKGGGIALNAVSKK
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3667564-3669087 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGACGCTTTTTACGACCGACTACCTGGAGTACTACCTCACCCTAGTCTCCTGGATCGTCCATAACGGAA
TCTGGGCCGTGCTGGTGTCCAGCGGGGTATTCGCGTTGCCTTTCGTGGCGATCATCGTGCAGGAATGGCT
CAAGGCACGCGCGGAAGGCGCGGACGAGGGCAACAAGGGCGTGCTGTCGGCTGCGCGCATTGAGAACCGG
GTGTTCGTCGCCATCGTGGTGGTGATGTTCGCTGGCATTCCGTTCATCGACGTGGACCTCAACACCATCC
AGTACGACAGCTCGCGCTCGGCGCAGTGCCAGGTCAGCGTGCCGCAGCCTACCGGCACGGGCTGGTCGCA
GTCCTTCTCGACGCTCAACAACCAGAGCGCCAAGCTGCCGGTGTGGTGGGCCTTCATGCACGCGCTCTCG
CGTGCGGTCACGGGAGCTTCCGTGGCGGCGATCCCTTGCGGCACTGATTTGCGGCAGATGCGGATGGAGA
TCGACGCCACGCGCATCGACGACCCGGTTTTGGCTCAGGAGGTCGCGGATTTCACGCACGACTGCTACGG
GCCGGCCCGCGCCAAGCTGTTCATGCAGCGCCCGAACCTCGATGAGGCGCAGATGCACGACGTGACCTGG
ATTGGCTCCCGCTTTTTCACGGACACGGCCGGCTACTACGACAACTATCGGTCGAGCACGCCACGCGATG
ACTGGCCTTACGACAGTGACCGTGATGCTGGGCTGGCCCAAGTGTCCAGCGGCGGTGGCTATCCGACCTG
CAGGCAATGGTGGGCCGACGGCAGCAATGGCTTGCGCGCGCGGCTGTTGGGCCAAGTGGACCCAAATCTG
CTCACGCGGGTGGCGGGCTGGGCCGGGTTTCTGAGCCGCGCCGAGGTGGACGACTCCGTGATCCGCACCA
TCGCTTCACCGAGACAGCAGAAACTGAACCAGGGGAGCGTCTATACGGACTACGGTGGCCAGATCGACAA
GACCTTGCCGAACGTCATCACGCGCGCGGCCGGCGACGTAGGAATGGCAGTCGGGGGAATCGCAGCGTTC
CCTGCCATGGACGTCGTTCGCCAGGCGCTGCCCATGGTGCTCGCCTTGCTCAAGATGGCGCTGGTCATCT
GCATCCCGCTCGTGCTGGTCATTGGCACCTATGACCTGAAGACGGTCGTTACCGTCAGCGTCGTGCAATT
CGCGCTGTTCTTCGTGGATTTTTGGTTCCAGCTCGCACGCTGGATCGACAGCACTATCCTCGACGCGCTC
TATGGGTGGGGCTGGGGCTGGAACCGGCCGCACAACAACTTTGATCCACTGGTCGGGTTGAACAATGCGT
TCGGCGACATGCTCCTGAACTTCGTCATGGGCACAATGTTCATCGTAATGCCCACCTTCTGGGTCATGGC
CTTGGCTTGGGCAGGCGTTCGCGCCGGCAACGTCCTTCAAGGCCTCGCTGGAGCCACGGGAGATGCCAAG
GCTGCAGGGGGTAAAGGAGGAGGTATTGCGCTCAACGCCGTGTCGAAAAAGTGA
 Primer design