SecReT4
Protein ID: 154253973
T4SS name [ID]Trb [341]
Gene symbol-
Locus tagPlav_3542
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3786650..3786982 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7HSD1
KEGG IDpla:Plav_1193, pla:Plav_3542
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.2e-23, Aligned region: 8..100
Protein Sequence: 110 a.a.     [Download]
>gi|154253973|ref|YP_001414797.1| conjugal transfer protein TrbC [Parvibaculum lavamentivorans DS-1]
MIRTTMRVRRYAATAAAFIYINLVLVPAAHASGSSMPWEAPLQKILESIEGPVAKIVAVIIIIATGLALA
FGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3786650-3786982 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGATCCGCACCACCATGCGCGTTCGCCGCTATGCCGCGACGGCCGCCGCCTTCATCTACATCAATCTCG
TCCTCGTTCCCGCCGCCCATGCCTCCGGCTCGTCCATGCCGTGGGAAGCACCGCTCCAGAAAATTCTCGA
ATCCATCGAAGGGCCGGTCGCCAAGATCGTCGCCGTCATCATCATCATCGCCACCGGCCTGGCGCTGGCG
TTCGGTGACACGTCCGGCGGCTTCCGGAAGCTGATCCAGATCGTCTTCGGTCTCAGCATCGCGTTTGCGG
CGTCGAGCTTCTTCCTGTCGTTCTTCTCATTCGGCGGCGGGGCGCTCATCTGA
 Primer design