SecReT4
Protein ID: 154253980
T4SS name [ID]Trb [341]
Gene symbol-
Locus tagPlav_3549
StrainParvibaculum lavamentivorans DS-1
Repliconchromosome [GenBank: NC_009719] [Browse all T4SS(s) in this replicon]
Location [Strand]3792856..3793836 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7HSC4
KEGG IDpla:Plav_1186, pla:Plav_3549
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.1e-62, Aligned region: 103..319
Protein Sequence: 326 a.a.     [Download]
>gi|154253980|ref|YP_001414804.1| P-type conjugative transfer protein TrbG [Parvibaculum lavamentivorans DS-1]
MSTSLRMSGSPAFRKSALAMMLLSATMLAGCATFKPPTISYDNDVPPLPAVPTPVTEQPPRPLHTPPAWT
VAHGGTTANTPSGRVENANAAARVEPRREGYYNAIQIYPWSEGALYQVYAAPGQITNIALEPGESLTGAG
PIAAGDTARWIIGDTESGSSLSRRVHILVKPTRPDITTNLVITTDRRIYMLELRAEAKPYMPAVAWAYPA
LPASQRGTVSATPIIPAAGARHYRYGLTGDTPPWRPVAVYDDGRRVYVEFPRGIVQGEMPPIFVLGTDGE
PQLVNSRIHQNILIVDRIFGAAELRLGSGKQQQTVRIVRTDGKPAS
 
Nucleotide Sequence: 981 bp     [Download]
>gi|154250456|ref|NC_009719.1|:3792856-3793836 Parvibaculum lavamentivorans DS-1 chromosome, complete genome
ATGAGCACATCTCTGCGCATGTCCGGCTCTCCGGCTTTCCGTAAATCCGCTTTGGCGATGATGCTGCTCT
CGGCAACGATGCTGGCGGGCTGCGCAACCTTCAAACCACCCACCATCAGCTACGACAATGACGTGCCGCC
GCTCCCAGCCGTGCCGACGCCGGTCACGGAACAGCCGCCGCGTCCGCTGCACACGCCTCCCGCCTGGACG
GTCGCGCATGGTGGAACCACCGCGAATACACCGAGCGGCCGCGTGGAAAACGCCAATGCTGCGGCGCGTG
TCGAACCGCGACGCGAGGGCTATTATAACGCCATCCAGATCTATCCCTGGAGCGAAGGCGCGCTTTACCA
AGTCTATGCCGCGCCCGGCCAGATCACCAACATCGCGCTCGAACCGGGCGAAAGTCTGACCGGCGCAGGT
CCAATCGCCGCCGGTGACACCGCCCGCTGGATCATCGGTGACACCGAAAGCGGTTCCAGCCTCTCGCGCC
GCGTCCACATCCTCGTCAAACCGACCCGCCCCGACATCACCACGAACCTGGTCATCACGACCGACCGCCG
CATCTACATGCTCGAGCTGAGGGCGGAGGCGAAACCCTATATGCCGGCCGTTGCCTGGGCTTATCCCGCG
CTACCGGCATCGCAACGTGGAACGGTCTCGGCGACGCCTATCATTCCCGCTGCCGGCGCACGTCACTACC
GCTACGGCCTCACCGGCGACACGCCGCCCTGGCGGCCGGTCGCCGTCTATGACGACGGCAGGCGTGTGTA
TGTCGAATTTCCACGCGGCATCGTTCAAGGCGAAATGCCGCCGATCTTCGTCCTCGGCACCGATGGCGAG
CCGCAGCTCGTCAACAGCCGCATCCACCAGAACATCCTGATCGTGGACCGCATCTTCGGCGCCGCCGAAC
TGCGCCTCGGCAGCGGCAAGCAGCAGCAGACCGTCAGGATCGTGCGAACCGATGGGAAACCTGCATCATG
A
 Primer design