SecReT4
Protein ID: 15426424
T4SS name [ID]VirB [188]
Gene symbol-
Locus tagXFa0065
StrainXylella fastidiosa 9a5c
Repliconplasmid pXF51 [GenBank: NC_002490] [Browse all T4SS(s) in this replicon]
Location [Strand]8978..9169 [+]
Productconjugal transfer protein
Component typeVirB7
UniProt IDP58337
KEGG IDxfa:XFa0065
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 63 a.a.     [Download]
>gi|15426424|ref|NP_203697.1| conjugal transfer protein [Xylella fastidiosa 9a5c]
MRYTFGIVTVYLLAGCAGSPPKPPEVKGKYRPINRVEAPASAGRNPVNSLNALCGNLNEKQCR
 
Nucleotide Sequence: 192 bp     [Download]
>gi|10956711|ref|NC_002490.1|:8978-9169 Xylella fastidiosa 9a5c plasmid pXF51, complete sequence
ATGCGTTACACCTTTGGCATTGTGACTGTCTACCTTCTAGCTGGATGTGCGGGTTCCCCGCCAAAACCGC
CAGAGGTGAAAGGCAAATACCGCCCTATCAACCGAGTTGAAGCACCCGCGTCAGCAGGCCGCAATCCGGT
TAATTCTCTCAATGCGCTGTGCGGGAATTTGAATGAAAAGCAATGTCGATAA
 Primer design