SecReT4
Protein ID: 15604158
T4SS name [ID]VirB [399]
Gene symbol-
Locus tagRP289
StrainRickettsia prowazekii str. Madrid E
Repliconchromosome [GenBank: NC_000963] [Browse all T4SS(s) in this replicon]
Location [Strand]353919..354650 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDQ9ZDN8
KEGG IDrpr:RP289
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|15604158|ref|NP_220673.1| hypothetical protein RP289 [Rickettsia prowazekii str. Madrid E]
MNNIFGFFKSSNNTQSASGGKQNQENIKSANPLKISQNWYEERSDKLIVQRNLLIILIILLTIFMVISTL
VIAFVVKSKQFDPFVIQLNSNTGRAAVVEPISSSMLTVDESLTRYFIKKYITARETYNPVDFATIARTTV
RLFSTSAVYYNYLGYIRNKDFDPTLKYKEDNTTFLVIKSWSKIADDKYIVRFSVNETSGSQLVYNKIAVV
SYDYVPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|15603881|ref|NC_000963.1|:353919-354650 Rickettsia prowazekii str. Madrid E chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACACGCAAAGTGCTTCAGGAGGTAAACAAAATC
AAGAAAATATAAAATCAGCTAATCCTTTAAAAATTAGTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
AATTGTTCAGAGAAACTTACTGATTATATTAATAATACTACTAACCATTTTTATGGTTATATCAACTTTA
GTTATAGCATTTGTAGTAAAATCTAAACAGTTTGATCCTTTTGTGATCCAGCTTAATAGTAATACTGGAC
GGGCTGCGGTGGTAGAACCTATTTCATCATCAATGTTAACTGTAGACGAATCTCTTACAAGATATTTTAT
AAAGAAATATATAACAGCACGTGAAACATATAATCCGGTTGATTTTGCTACTATAGCTCGTACAACAGTA
AGATTATTTTCCACAAGTGCTGTTTATTATAATTATCTTGGATATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGATAATACTACATTTTTAGTAATAAAGTCATGGTCCAAAATCGCAGACGATAA
ATATATAGTTAGATTTTCTGTAAATGAAACATCAGGAAGTCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGATTATGTGCCTATGCAATTAACAGATTCAGAACTTGACATAAATCCAGTAGGGTTTCAAGTTA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design