SecReT4
Protein ID: 15604161
T4SS name [ID]VirB [399]
Gene symbol-
Locus tagRP292
StrainRickettsia prowazekii str. Madrid E
Repliconchromosome [GenBank: NC_000963] [Browse all T4SS(s) in this replicon]
Location [Strand]356641..357645 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ9ZDN5
KEGG IDrpr:RP292
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.2e-94, Aligned region: 13..312
Protein Sequence: 334 a.a.     [Download]
>gi|15604161|ref|NP_220676.1| type IV secretion system ATPase VirB11 [Rickettsia prowazekii str. Madrid E]
MNEEFAALETFLLPFKNLFAEEGINEIMVNKPGEAWVEKRGDIYSKQIPELDSDHLLALGRLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYSIRKPSGMNLTLDEYAQMGAFDNTATESLVDEDADIL
NNFLAEKKIKEFIRYAVISKKNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADFGMPPEEVKKYILSVVDIVVQLKRASGGKRYVSEVYYKKNKNSESML
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|15603881|ref|NC_000963.1|:356641-357645 Rickettsia prowazekii str. Madrid E chromosome, complete genome
ATGAATGAAGAATTTGCAGCCTTAGAGACGTTTTTATTGCCTTTTAAAAATTTATTTGCTGAAGAAGGTA
TTAACGAAATTATGGTTAATAAGCCTGGAGAAGCATGGGTTGAGAAAAGAGGTGATATATATTCTAAGCA
AATACCAGAATTGGATAGCGACCATCTACTTGCATTAGGGCGTTTAGTAGCGCAATCTACAGAACAGATG
ATTTCAGAAGAAAAACCGCTACTTTCAGCAACTTTGCCGAATGGCTACCGTATCCAAATAGTATTTCCTC
CTGCGTGTGAGATAGGACAAATCATTTATTCTATAAGAAAGCCTAGTGGTATGAATTTAACTTTAGATGA
ATATGCTCAAATGGGAGCATTTGATAACACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGATATTTTA
AATAATTTTTTAGCTGAAAAAAAAATTAAAGAATTTATTCGATATGCAGTTATTTCAAAAAAAAATATCA
TAATTAGTGGTGGTACTTCAACCGGTAAAACTACTTTTACTAATGCTGCACTTACTGAAATACCTGCAAT
AGAGAGATTAATTACTGTAGAAGATGCTCGTGAAGTTGTACTATCAAGTCATCCTAATAGAGTGCATTTA
CTTGCTTCTAAAGGTGGACAGGGTCGTGCAAATGTTACTACACAAGATTTAATAGAGGCATGTTTGCGTT
TAAGACCGGATAGAATTATAGTCGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTACGTGCTATTAA
TACAGGTCATCCAGGCTCAATATCAACATTGCATGCTGATAGTCCTGCTATGGCTATTGAACAGTTAAAG
CTTATGGTTATGCAAGCAGATTTTGGTATGCCACCTGAAGAAGTAAAAAAGTATATTTTAAGCGTTGTAG
ATATTGTGGTACAGTTAAAACGTGCTAGTGGTGGAAAAAGATATGTTTCAGAAGTGTACTACAAAAAAAA
TAAGAATTCTGAATCTATGTTATAG
 Primer design