SecReT4
Protein ID: 15604162
T4SS name [ID]VirB [399]
Gene symbol-
Locus tagRP293
StrainRickettsia prowazekii str. Madrid E
Repliconchromosome [GenBank: NC_000963] [Browse all T4SS(s) in this replicon]
Location [Strand]357947..359722 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ9ZDN4
KEGG IDrpr:RP293
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.9e-168, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 1.7e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 2e-21, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 4.9e-05, Aligned region: 306..481
Protein Sequence: 591 a.a.     [Download]
>gi|15604162|ref|NP_220677.1| type IV secretion system component VirD4 [Rickettsia prowazekii str. Madrid E]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWITGVFVAIFTNEIRALGADINAINIAYKWAYWLINVWWQLK
IADYNYLKLKLIVSLFGPAIIVIIFYIKNFQRIKALQFFEQPEKVYGDASWANQSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWTDSVVVHDIKLENHNLTSGWREKQGQKVFVWE
PSNPDGITHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNSTYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFNHMANNNEAAEETKTTNVIENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|15603881|ref|NC_000963.1|:357947-359722 Rickettsia prowazekii str. Madrid E chromosome, complete genome
ATGGAATGGCATAAGATACTTAAGGTTACTAGGAATATATTTGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGCACCATTTGGATCACTGGTGTGTTTGTTGCAATTTTTACTAATGAGATTAGAGCTTTAGGCGC
AGACATAAATGCTATAAATATTGCGTATAAGTGGGCTTACTGGCTTATTAATGTTTGGTGGCAATTAAAA
ATTGCCGACTATAATTATTTAAAATTGAAGCTAATTGTATCTCTTTTTGGTCCTGCTATTATTGTTATAA
TATTTTACATTAAAAATTTTCAAAGAATAAAAGCATTACAATTTTTTGAGCAGCCTGAAAAAGTATATGG
TGATGCGAGTTGGGCTAATCAGTCTGATATAGAAGCTGCTGGCCTTAGATCAAAAAAAGGCATGTTAATA
GGGGTTGATGCTGGTGGATATTTTGTTGCGGATGGGTTTCAACATGCTTTATTATTCGCCCCTACTGGGT
CAGGTAAAGGTGTTGGTTTTGTAATACCTAATCTTTTATTTTGGACTGATTCAGTAGTAGTACATGATAT
AAAGCTTGAAAATCACAATTTGACTAGTGGTTGGCGTGAGAAACAAGGGCAGAAAGTTTTTGTTTGGGAG
CCTTCTAATCCGGACGGTATTACACATTGTTATAATCCAATTGATTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGATGTACAGAAAATTTCAAATCTTATAATGCCTGAAAAGGATTTTTGGAATAATGAAGCGCG
CAGTTTATTCTTAGGTGTAACTTTATATTTAATAGCCGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACAATGAGAAGTGACGATGTAGTTTATAATCTAGCAGTTGTACTTGATACGCTTGGTGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCATTTTTGCAAAAAGCTGATAAAGAGCGTTCTGGTGTAAT
ATCTACAATGAATTCATCACTTGAATTATGGGCAAATCCACTTATTGATTCTGCAACTGCATCTTCTGAC
TTTAATATACAAGAATTTAAAAAAGTGAAAACAACAGTGTATGTAGGATTAACACCTGATAATATACAGC
GTTTGCAAAAATTAATGCAGGTGTTTTATCAGCAAGCTACAGAATTTTTAAGCCGTAAAATGCCCGATTT
AAAGGAAGAACCATATGGAGTAATGTTCTTACTTGATGAATTCCCGACGCTTGGAAAGATGGATACTTTT
AAAGCTGGTATCGCTTATTTTAGAGGTTATAGAGTTCGATTATTTTTGATTATTCAAGATACGCAGCAAT
TAAAAGGAACATATGAAGATGCTGGTATGAATTCTTTCTTATCTAATTCTACATATCGTATTACCTTTGC
TGCTAATAACTATGAAACTGCAAATTTAATATCGCAGCTTGTTGGTAATAAAACGGTAGAACAAAGGTCA
TTTAGTAAACCTTTATTTTTTGATCTTAATATTTCTACTAGAACCCAAAACGTATCCCAAGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGAGGGATGAGCAAATTGTTTTAATTGAATCCTTCCC
GCCTATAAAATCTCGTAAAATTAAGTATTACGAAGATAAGTTTTTTACTAGTAGATTATTACCGCCAACT
TTTGTACCTACTCAAGTACCTTTTAATCATATGGCAAATAATAATGAGGCTGCTGAAGAGACTAAAACAA
CAAATGTTATCGAAAATAATGAGTAA
 Primer design