SecReT4
Protein ID: 15611538
T4SS name [ID]Cag [38]
Gene symbolorf8
Locus tagjhp0471
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]511642..513087 [+]
Productcag island protein
Component typeCagdelta
UniProt IDQ9ZLV5
KEGG IDhpj:jhp0471
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|15611538|ref|NP_223189.1| cag island protein [Helicobacter pylori J99]
MFRKLATSVSLISLLISNALYAKEISEADKVIKATKETKETKKEAKRLKKEAKQRQQIPDNKKPQYVSVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKNKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINDKIPYAQATFLRVPKRSDPNAHTLDKGASIDESKLFEQQKKM
YFNYANDVICRPNDEVCSPLRDEMVAMPTNDSVTQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPEN
SKEKLIEELIANSQLIANEEEREKKLLAEKEKQETELAKYKLKDLENQKKLKALEAELKKKNTKKPRVVE
VPIPPKTSDSDETMRVIKEKENYNGLLVDKETTIKRSYKGTLISENSYSKKTPINLEDLRSLEEEIKSYY
VKSNGLCYANGINLYVKIKNDPYKEGMLCGYESVQKLLSPLRDKLKYDKQKLQKALLKDLK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|15611071|ref|NC_000921.1|:511642-513087 Helicobacter pylori J99 chromosome, complete genome
ATGTTTAGAAAACTAGCAACCTCTGTATCGCTCATAAGCCTACTAATCTCCAACGCTCTTTATGCTAAAG
AAATAAGTGAAGCCGATAAGGTCATTAAGGCCACTAAAGAAACTAAAGAGACCAAGAAAGAGGCTAAACG
CCTCAAAAAAGAAGCTAAACAGCGCCAACAGATCCCTGATAATAAGAAACCTCAATATGTCTCTGTTGAT
GACACAAAAACTCAAGCGCTTTTTGATATATATGACACTTTGAATGTGAATGACAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAAACAAAACTTATCTCTACGCTATGGATCTATTGGATTATAACAACTA
CTTATCCATAGAAAACCCTATTATCAAAACAAGAGCGATGGGAACTTATGCAGATCTGATTATCATCACA
GGTTCGTTAGAACAAGTCAATGGGTATTACAATATTCTAAAAGCGCTCAACAAACGCAACGCTAAGTTTG
TGTTAAAAATCAATGACAAAATACCTTATGCCCAAGCGACTTTTTTGAGAGTGCCAAAAAGAAGCGATCC
CAACGCCCACACGCTTGATAAGGGAGCGTCAATTGATGAAAGCAAGCTTTTTGAACAACAAAAGAAAATG
TATTTCAACTACGCCAACGATGTGATCTGCAGACCCAACGATGAAGTGTGTTCGCCCCTAAGAGATGAAA
TGGTAGCTATGCCCACTAACGATAGCGTTACTCAAAAACCCAATATCATTGCTCCTTATAGCCTGTATAG
ACTAAAAGAGACAAATAACGCCAATGAAGCCCAACCATCACCTTATGCCACTCAAACCGCTCCTGAAAAC
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCCAACTCCCAACTCATAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGACTGAATTGGCTAAATACAAGCTCAAAGATTTAGAAAA
TCAAAAGAAACTAAAAGCTTTAGAAGCAGAGTTGAAAAAGAAAAACACTAAGAAACCTAGAGTAGTGGAA
GTGCCTATTCCTCCTAAAACAAGTGATTCTGATGAAACAATGAGAGTTATCAAAGAAAAAGAAAACTATA
ATGGGTTATTAGTGGATAAAGAGACCACGATCAAAAGAAGCTATAAGGGGACTTTGATCAGTGAAAATTC
TTACAGCAAAAAAACACCCATCAACCTTGAGGACTTGAGAAGCTTAGAAGAAGAAATTAAGAGCTACTAT
GTCAAGTCTAATGGCTTGTGTTACGCTAATGGCATTAACCTCTATGTAAAAATCAAAAACGATCCCTACA
AAGAGGGAATGCTGTGTGGTTATGAGAGCGTTCAAAAACTGCTTTCACCACTAAGGGACAAGCTCAAATA
CGACAAGCAGAAGTTACAAAAAGCGTTACTGAAAGATTTAAAGTAA
 Primer design