SecReT4
Protein ID: 15611540
T4SS name [ID]Cag [38]
Gene symbolvirD4
Locus tagjhp0473
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]514088..516334 [-]
Productcag island protein, DNA transfer protein
Component typeCagbeta
UniProt IDQ9ZLV3
KEGG IDhpj:jhp0473
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-179, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.6e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.8e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|15611540|ref|NP_223191.1| cag island protein, DNA transfer protein [Helicobacter pylori J99]
MEDFLYNTLYFIEDYKLVVIFSFIGLIALFFLYKFIKTQKKVFKDKANQPQKKKSFKEIIIDGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNRLPESDDDLFDIWVYAIQDFPAYYFKALTFSSLKIYG
FNISLVVYSSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRAF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRALSPATRNMWNNFKTMGGAKETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDAVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPNQATFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c516334-514088 Helicobacter pylori J99 chromosome, complete genome
ATGGAAGACTTTTTGTATAACACCTTATATTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTCCTCTACAAATTCATAAAAACTCAAAAAAAGGTTTTTAAAGATAAAGC
TAACCAGCCTCAAAAGAAAAAAAGCTTTAAAGAAATCATTATAGATGGGCTGAAAGAAAGGGTTAAAACC
TTTGGCTTTTGGTTGCAAGCTATACTATTACTATCCTATTCTTTTATCACATCAGGGTTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGATGATAATAGATTGCCTGAGAGCGATGATGATCTTTTTGATATATGGGT
CTATGCGATACAAGATTTTCCTGCATACTATTTTAAGGCACTCACTTTTAGCTCGCTCAAGATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATATATTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGGGACATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGTAGCGC
GAGTTGGGAAACTGAAGAGAAAATGATCAAAGCCAAGCTTATCACACCCAACAATAAAAAACGCGCCTTT
GACAAACGAGAGGTTATTGTAGGCAGGCGTGGCTTAGGGGATTTTATCGCTTACGCAGGACAGGCGTTTA
TTGGCTTGATTGCTCCTACTAGGAGCGGTAAGGGTGTGGGTTTCATCATGCCCAATATGATCAATTACCC
TCAAAATATCGTTGTGTTTGATCCTAAGGCTGACACTATGGAAACTTGCGGGAAAATCAGAGAAAAACGC
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAATGATGTGGTTTTGACTGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGCATGGTGGCTAGTGGAGGGGATTTTTCCACTCAAATCTTTGGATTGGCTAAGTTGGTGTTCCCTGAA
AGACCTAATGAAAAAGATCCTTTTTTTAGCAATCAGGCGCGAAACCTTTTTGTCATCAATTGCAATATTT
ATAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCCACGATGTTTTTCATAGGTTCTATGGCAAGCGGTATCAACTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTTTAATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGACAATCTAAGAGCGCTTA
GTCCTGCCACTAGAAACATGTGGAATAACTTCAAGACAATGGGTGGCGCTAAAGAAACTTACAGCTCGGT
TCAAGGGGTCTATACATCAGCGTTTGCGCCTTACAATAACGCCATGATCAGGAATTTCACGAGCGCTAAT
GATTTTGATTTCAGGCGTTTAAGGATCGATGCAGTGAGTATTGGTGTGATCGCTAATCCTAAAGAAAGCA
CTATTGTTGGACCGATATTAGAGCTGTTTTTCAACGTGATGATTTATAGCAATTTGATTCTGCCAATCCA
TGATCCACAATGCAAAAGAAGCTGCTTGATGCTCATGGATGAATTTACGCTCTGTGGCTATTTAGAGACC
TTTGTTAAAGCGGTAGGGATCATGGCAGAATACAACATGCGCCCCGCTTTTGTGTTTCAAAGTAAGGCGC
AATTAGAAAACGACCCCCCACTTGGTTATGGTAGGAATGGCGCTAAGACTATTTTAGACAACCTTTCTTT
GAATATGTATTATGGGATCAACAACGATAACTACTATGAACATTTTGAAAAGCTTTCTAAAGTGTTAGGG
AAATACACAAGGCAAGATGTGAGCCGGAGCATTGATGATAATACGGGTAAGACCAACACTTCTATCAGCA
ACAAGGAGCGGTTTTTGATGACCCCTGATGAATTGATGACTATGGGCGATGAGCTTATCATTTTAGAAAA
CACGCTCAAACCCATCAAGTGCCACAAGGCGCTTTACTATGATGATCCCTTCTTCACCGATGAGCTCATT
AAGGTGAGTCCAAGCTTGAGCAAGAAATACAAATTGGGGAAAGTGCCTAATCAAGCAACATTTTATGATG
ACTTGCAAGCCGCTAAAACCAGAGGCGAATTGAGCTATGATAAATCTTTAGTGCCTGTGGGTTCAAGCGA
ACTGTGA
 Primer design