SecReT4
Protein ID: 15611543
T4SS name [ID]Cag [38]
Gene symbolorf13/14
Locus tagjhp0476
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]518074..523533 [-]
Productcag island protein
Component typeCagY
UniProt IDQ9ZLV0
KEGG IDhpj:jhp0476
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 0, Aligned region: 325..351
CagY_M [PF07337], Evalue: 0, Aligned region: 359..386
CagY_M [PF07337], Evalue: 0, Aligned region: 396..424
CagY_M [PF07337], Evalue: 0, Aligned region: 438..470
CagY_M [PF07337], Evalue: 0, Aligned region: 471..501
CagY_M [PF07337], Evalue: 0, Aligned region: 507..538
CagY_M [PF07337], Evalue: 0, Aligned region: 540..564
CagY_M [PF07337], Evalue: 0, Aligned region: 576..608
CagY_M [PF07337], Evalue: 0, Aligned region: 615..647
CagY_M [PF07337], Evalue: 0, Aligned region: 653..684
CagY_M [PF07337], Evalue: 0, Aligned region: 686..714
CagY_M [PF07337], Evalue: 0, Aligned region: 722..754
CagY_M [PF07337], Evalue: 0, Aligned region: 760..792
CagY_M [PF07337], Evalue: 0, Aligned region: 798..830
CagY_M [PF07337], Evalue: 0, Aligned region: 836..868
CagY_M [PF07337], Evalue: 0, Aligned region: 874..906
CagY_M [PF07337], Evalue: 0, Aligned region: 912..943
CagY_M [PF07337], Evalue: 0, Aligned region: 945..973
CagY_M [PF07337], Evalue: 0, Aligned region: 981..1013
CagY_M [PF07337], Evalue: 0, Aligned region: 1019..1051
CagY_M [PF07337], Evalue: 0, Aligned region: 1058..1089
CagY_M [PF07337], Evalue: 0, Aligned region: 1091..1119
CagY_M [PF07337], Evalue: 0, Aligned region: 1127..1159
CagY_M [PF07337], Evalue: 0, Aligned region: 1165..1197
CagY_M [PF07337], Evalue: 0, Aligned region: 1203..1235
CagY_M [PF07337], Evalue: 0, Aligned region: 1242..1274
CagY_M [PF07337], Evalue: 0, Aligned region: 1281..1315
CagY_M [PF07337], Evalue: 0, Aligned region: 1320..1347
CagY_M [PF07337], Evalue: 0, Aligned region: 1369..1403
TrbI [PF03743], Evalue: 2.5e-36, Aligned region: 1583..1779
Protein Sequence: 1819 a.a.     [Download]
>gi|15611543|ref|NP_223194.1| cag island protein [Helicobacter pylori J99]
MNEENDKLETSKKAQQDSPQDLSNEEATEANHFEDLLKESTESSDNHLDNPTETKTHFDEDKLEETQTQM
DSGGNETSESSNGSLADKLFKKARKLVDDKRPFTQQKSLDEETQKLNEEDDQENNEHQEETQTDLIDDET
SEKTQQDSPQDLSNEEATEANHFEDLLKESTESSDNHLDNPTESSDNHLDNPTETKTQETKTHFDEDKPE
EITDDSNDQEIIKGSKKKYIIGGIVVAVLIVIILFSRSIFHYFVPLEDKSSRFSKDRNLYVNDEIQIRQE
YNRLLKERNEKGNMIDKNLFFNDDPNRTLYNYLNIAEIEDKNPLRAFYECISNGGNYEECLKLIKDKKLQ
DQMKKTLEAYNDCIKNAKTEEERIKCLDLIKDENLKKSLLNQQKVQVALDCLKNAKTDEERKECLKLIND
PEIREKFRKELELQKELQEYKDCIKNAKTEAEKNECLKGLSKEAIERLKQQALDCLKNAKTDEERKECLK
NIPQDLQKELLADMSVKAYKDCVSRARNEKEKQECEKLLTPEAKKLLENQALDCLKNAKTDEERKECLKN
LPKDLQSDILAKESLKAYKDCASQAKTEAEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEAEK
KECEKLLTPEAKKKLEEAKKSVRAYLDCVSKAKNEAERKECEKLLTPEAKKLLENQALDCLKNAKTDEER
KECLKDLPKDLQKKVLAKESVRVYLDCVSKAKNEAERKECEKLLTPEARKLLEEAKKSVKAYKDCVLRAR
NEKEKQECEKLLTPEARKLLEESKKSVKAYLDCVSKAKNEAERKECEKLLTPEARKLLEEAKESVKAYKD
CVSRARNEKEKQECEKLLTPEARKLLEESKKSVKAYLDCVSKAKNEAERKECEKLLTPEARKLLEEAKES
VKAYKDCVSRARNEKEKQECEKLLTPEAKKLLENQALDCLKNAKTEAEKKRCVKDLPKDLQKKVLAKESV
RVYLDCVSKAKNEAERKECEKLLTPEARKLLEEAKESVKAYKDCVSRARNEKEKQECEKLLTPEARKLLE
QEVKKSVKAYLDCVSRARNEKEKQECEKLLTPEARKLLENQALDCLKNAKTEAEKKRCVKDLPKDLQKKV
LAKESVKAYLDCVSRARNEKEKKECEKLLTPEARKLLEESKKSVKAYLDCVSKAKNEAEKKECEKLLTPE
ARKLLEEAKESVKAYKDCVSRARNEKEKQECEKLLTPEARKLLEQEVKKSVKAYLDCVSRARNEKEKQEC
EKLLTPEARKFLEKQRQQKDKAIKDCLKNADPNDRAAIMKCLDGLSDEEKLKYLQEAREKAVLDCLKTAR
TDEEKRKCQNLYSDLIQEIQNKKAQNKQNQLSKTERLHQASECLDNLDDPTDQEAIEQCLEGLSDSERAL
ILGIKRQADEVDRIYSDLRSRKTFDNMAAKGYPLLPMDFKNGGDIATINATNVDADKIASDNPIYASIEP
DITKQYETEKTIKDKSLEAKLAKALGGDKKDDDKEKGKKPTAETKAESNKIDKDVAETAKNISEIALKNK
KEKSGDFVDENGNPIDDKKKEEKQDETSPVKQAFIGKSDPTFVLAQYTPIEITLTSKVDATLTGIVSGVV
AKDVWNMNGTMILLDKGTKVYGNYQSVKGGTPIMTRLMIVFTKAITPDGVIIPLANAQAAGMLGEAGVDG
YVNNHFMKRIGFAVIASVVNSFLQTAPIIALDKLIGLGKGRSERTPEFNYALGQAINGSMQSSAQMSNQI
LGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYDVKITNKSVVDEIIKQSTKTLSREHEEITTSPKGGN
 
Nucleotide Sequence: 5460 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c523533-518074 Helicobacter pylori J99 chromosome, complete genome
ATGAATGAAGAAAACGATAAACTTGAAACTTCTAAAAAAGCCCAACAAGATTCACCCCAAGATCTATCTA
ATGAAGAAGCAACAGAAGCCAATCATTTTGAAGATCTTTTAAAAGAATCCACAGAAAGCTCAGACAATCA
TCTTGACAACCCCACAGAAACTAAAACCCATTTTGATGAAGACAAGCTAGAAGAAACCCAAACTCAAATG
GATTCTGGAGGTAATGAAACTTCAGAATCTAGCAATGGCAGTCTAGCAGACAAGTTATTCAAGAAAGCCA
GAAAATTAGTTGATGATAAAAGACCTTTCACTCAGCAAAAGAGTTTAGATGAAGAAACCCAAAAACTGAA
CGAAGAAGACGATCAAGAAAATAATGAGCATCAAGAAGAAACTCAAACGGACTTGATTGATGATGAAACT
TCTGAAAAAACCCAACAAGATTCACCCCAAGATCTATCTAATGAAGAAGCAACAGAAGCCAATCATTTTG
AAGATCTTTTAAAAGAATCCACAGAAAGTTCAGATAATCATCTTGACAACCCCACAGAAAGCTCAGACAA
TCATCTTGACAACCCCACAGAAACTAAAACCCAAGAAACTAAAACCCATTTTGATGAAGACAAGCCAGAA
GAAATAACTGACGACTCTAACGATCAAGAGATTATCAAAGGAAGCAAAAAGAAATACATTATTGGCGGCA
TTGTAGTCGCTGTTCTTATCGTGATTATTTTATTTTCTAGAAGCATTTTTCACTACTTTGTACCTTTGGA
AGATAAAAGCTCTCGTTTTAGCAAAGACAGGAATCTTTATGTCAATGATGAAATCCAAATAAGGCAAGAG
TATAACCGATTGCTGAAAGAACGGAATGAAAAAGGCAATATGATCGATAAGAATCTTTTCTTCAATGACG
ATCCCAATAGAACCTTATACAACTATTTGAATATTGCAGAAATTGAGGACAAAAACCCATTGAGAGCCTT
TTATGAATGTATTAGTAATGGTGGCAACTATGAAGAATGTTTGAAGCTTATCAAAGACAAAAAACTTCAA
GATCAGATGAAAAAGACTCTAGAGGCTTATAATGACTGCATCAAAAATGCCAAAACTGAAGAAGAAAGGA
TCAAGTGTTTAGATTTAATCAAAGATGAAAACCTGAAAAAAAGCTTACTGAACCAACAAAAAGTTCAAGT
GGCTCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGGAAAGAGTGCCTAAAACTCATAAATGAC
CCTGAGATTAGAGAGAAATTCCGTAAGGAATTAGAGCTTCAAAAAGAGCTTCAAGAGTATAAGGATTGTA
TCAAAAACGCCAAAACAGAAGCTGAGAAAAACGAATGCTTGAAAGGCTTGTCTAAAGAAGCCATAGAAAG
ATTGAAACAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGGAAAGAGTGCTTAAAA
AATATTCCCCAAGACTTGCAAAAAGAACTACTAGCTGATATGAGCGTTAAGGCTTACAAAGACTGCGTAT
CAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGAAAAAACTATT
AGAGAATCAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGGAAAGAGTGCTTGAAAAAT
CTCCCTAAAGACTTACAAAGCGATATTTTAGCTAAAGAGAGCCTGAAAGCTTATAAAGACTGCGCATCTC
AAGCCAAAACTGAAGCTGAAAAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAAAAAACTTTTAGA
AGAAGAAGCCAAAGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAGGCCAAAACTGAAGCTGAAAAA
AAAGAATGCGAGAAATTGCTCACACCTGAAGCGAAAAAAAAGTTAGAAGAAGCCAAAAAGAGCGTTAGAG
CTTATTTGGATTGCGTATCAAAAGCCAAAAACGAAGCTGAAAGAAAAGAATGCGAGAAATTACTCACGCC
TGAAGCGAAAAAACTATTAGAGAATCAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGG
AAAGAGTGCTTGAAAGATCTCCCTAAAGACTTACAGAAAAAGGTTTTAGCCAAAGAGAGTGTTAGGGTTT
ATTTGGATTGCGTATCAAAAGCCAAAAACGAAGCTGAAAGAAAAGAATGCGAGAAATTGCTCACCCCTGA
AGCGAGAAAGCTATTAGAAGAAGCTAAGAAGAGCGTTAAGGCTTACAAAGACTGCGTTTTAAGAGCTAGG
AATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGGAAACTATTAGAAGAATCTA
AAAAAAGCGTTAAGGCTTATTTGGATTGCGTATCAAAAGCCAAAAACGAAGCTGAAAGAAAAGAATGCGA
GAAATTGCTCACCCCTGAAGCGAGAAAGCTATTAGAAGAAGCTAAAGAGAGTGTTAAGGCTTACAAAGAC
TGCGTATCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGGA
AACTATTAGAAGAATCTAAAAAAAGCGTTAAGGCTTATTTGGATTGCGTATCAAAAGCCAAAAACGAAGC
TGAAAGAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAGAAAGCTATTAGAAGAAGCTAAAGAGAGT
GTTAAGGCTTACAAAGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTAC
TCACGCCTGAAGCGAAAAAACTATTAGAGAATCAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGAAGC
TGAGAAAAAAAGGTGTGTCAAAGATCTCCCTAAAGACTTACAGAAAAAGGTTTTAGCCAAAGAGAGTGTT
AGGGTTTATTTGGATTGCGTATCAAAAGCCAAAAACGAAGCTGAAAGAAAAGAATGCGAGAAATTGCTCA
CCCCTGAAGCGAGAAAGCTATTAGAAGAAGCTAAAGAGAGTGTTAAGGCTTACAAAGACTGCGTATCAAG
AGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACCCCTGAAGCTAGGAAACTATTAGAG
CAAGAAGTTAAAAAGAGCGTTAAGGCTTATTTAGACTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAAC
AAGAATGCGAGAAATTACTCACGCCTGAAGCGAGGAAACTTTTAGAGAATCAAGCGCTAGATTGTTTGAA
AAACGCTAAAACCGAAGCTGAGAAAAAAAGGTGTGTCAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTT
TTAGCTAAAGAGAGCGTTAAGGCTTATTTAGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAAG
AATGCGAGAAGTTGCTCACGCCTGAAGCGAGAAAACTATTAGAAGAATCTAAAAAAAGCGTTAAGGCTTA
TTTGGATTGCGTATCAAAAGCCAAAAACGAAGCTGAAAAAAAAGAATGCGAGAAATTGCTCACACCTGAA
GCGAGAAAGCTATTAGAAGAAGCTAAAGAGAGTGTTAAGGCTTACAAAGACTGCGTATCAAGAGCTAGGA
ATGAAAAAGAGAAACAAGAATGCGAGAAACTACTCACCCCTGAAGCGAGGAAACTATTAGAGCAAGAAGT
TAAAAAGAGCGTTAAGGCTTATTTAGACTGTGTATCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGC
GAGAAATTACTCACCCCTGAAGCGAGGAAATTTTTAGAGAAACAGCGCCAACAAAAAGATAAAGCGATAA
AGGATTGCTTGAAAAACGCCGATCCTAACGACAGAGCGGCTATCATGAAGTGTTTGGATGGTTTGAGCGA
TGAAGAGAAGCTCAAATACCTGCAAGAAGCCAGAGAAAAGGCTGTCTTGGATTGTTTGAAAACGGCTAGG
ACCGATGAAGAAAAAAGGAAATGCCAAAACCTTTATAGCGATTTGATCCAAGAAATCCAAAATAAAAAGG
CACAGAACAAACAAAATCAATTGAGTAAAACAGAAAGGTTGCATCAAGCAAGCGAGTGCTTGGATAACTT
AGATGACCCTACTGATCAAGAAGCCATAGAGCAATGTTTAGAGGGATTGAGCGATAGCGAAAGGGCGCTA
ATTCTAGGAATCAAACGACAAGCTGATGAAGTGGATCGGATTTATAGCGATCTAAGAAGCCGCAAAACCT
TTGATAACATGGCGGCTAAAGGTTATCCATTGTTACCAATGGATTTTAAAAATGGTGGCGATATTGCTAC
TATTAACGCCACTAATGTTGATGCGGACAAAATAGCTAGCGATAATCCTATTTATGCTTCCATAGAGCCT
GATATTACTAAGCAATACGAAACAGAGAAAACCATTAAGGATAAGAGTTTAGAAGCTAAATTAGCTAAGG
CTTTAGGTGGCGATAAGAAAGATGACGATAAAGAAAAAGGTAAAAAACCCACAGCAGAAACTAAAGCAGA
AAGCAATAAGATAGACAAAGATGTCGCAGAAACTGCCAAAAATATCAGCGAAATCGCTCTTAAGAACAAA
AAAGAAAAGAGTGGGGATTTTGTAGATGAAAATGGTAATCCCATTGATGATAAAAAGAAAGAAGAAAAAC
AAGATGAAACAAGCCCTGTCAAACAGGCCTTTATAGGCAAGAGTGATCCCACATTTGTTTTAGCACAATA
CACTCCCATTGAAATCACTCTGACTTCTAAAGTAGATGCCACTCTCACGGGTATAGTGAGTGGGGTTGTA
GCCAAAGATGTATGGAACATGAACGGCACTATGATCTTATTAGACAAAGGCACTAAGGTGTATGGGAATT
ATCAAAGCGTGAAAGGTGGCACGCCTATTATGACTCGTTTAATGATAGTCTTTACTAAAGCTATTACGCC
TGATGGGGTGATTATACCTCTAGCAAACGCTCAAGCAGCAGGCATGCTGGGTGAAGCAGGGGTAGATGGC
TATGTGAATAATCACTTCATGAAGCGCATAGGCTTTGCTGTGATAGCAAGCGTGGTTAATAGCTTCTTGC
AAACTGCGCCTATCATAGCCCTAGATAAACTCATAGGTCTTGGCAAAGGCAGAAGTGAAAGGACACCTGA
ATTTAATTACGCTTTGGGTCAAGCTATCAATGGCAGTATGCAAAGTTCAGCTCAGATGTCTAATCAAATT
CTAGGGCAACTGATGAATATCCCCCCAAGTTTTTACAAAAATGAGGGCGATAGCATTAAGATTCTCACCA
TGGACGATATTGATTTTAGTGGCGTGTATGATGTTAAAATTACCAACAAATCTGTGGTAGATGAAATTAT
CAAACAAAGCACCAAAACTTTGTCTAGAGAACATGAAGAAATCACCACAAGCCCCAAAGGTGGCAATTGA
 Primer design