SecReT4
Protein ID: 15611544
T4SS name [ID]Cag [38]
Gene symbolorf15
Locus tagjhp0477
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]523548..525116 [-]
Productcag island protein
Component typeCagX
UniProt IDQ9ZLU9
KEGG IDhpj:jhp0477
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.3e-38, Aligned region: 55..171
CagX [PF03524], Evalue: 2.3e-38, Aligned region: 259..490
Protein Sequence: 522 a.a.     [Download]
>gi|15611544|ref|NP_223195.1| cag island protein [Helicobacter pylori J99]
MGQAFFKKIVGCFCLGYLFLSSAIEAVALDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLE
KDETISYITTGFNKGWSIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKE
LEEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSELIKQQRENE
LDQMERLEDMQEQAQANALKQIEELNKKQAEEAVRQRAKDKISIKTDKSQKSPEDNSIELSPSDSAWRTN
LVVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQRELIKQENLNTTAY
INRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIF
DDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKDKALVTVINK
GYGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c525116-523548 Helicobacter pylori J99 chromosome, complete genome
ATGGGGCAGGCATTTTTTAAAAAAATTGTTGGCTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGCAA
TAGAAGCAGTAGCACTTGACATTAAGAATTTTAATCGTGGTAGGGTGAAAGTGGTGAATAAGAAGATTGC
TTATTTGGGAGATGAAAAACCTATTACGATTTGGACTTCATTAGACAATGTTACCGTGATCCAACTTGAA
AAAGATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAGTATTGTGCCTAATTCTAATC
ATATATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCCCT
AATGACAAGAGATTACCAAGAATTTTTAAAGACAAAAAAACTTATCGTAGATGCGCCTGACCCTAAAGAA
TTAGAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAGGCGCAAAAGGCACAAAAAG
ATAAAAGAGAAAAAAGAAAGGAGGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTAT
GAGTAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTGATCAAGCAACAGAGAGAAAATGAA
TTAGACCAAATGGAACGACTAGAGGACATGCAAGAGCAGGCTCAAGCTAACGCACTCAAACAAATTGAAG
AGCTCAACAAGAAACAAGCTGAAGAGGCAGTTAGGCAAAGAGCCAAGGATAAAATCAGTATTAAGACAGA
TAAATCTCAAAAAAGCCCCGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGGACTAAT
CTTGTTGTGCGGACCAATAAAGCCTTGTATCAATTCATTTTGAGGATAGCCCAAAAAGACAATTTTGCTT
CAGCGTATCTAACAGTCAAATTAGAATACCCACAAAGACACGAAGTCTCTAGCGTTATTGAAGAGGAATT
AAAAAAGAGAGAAGAAGCAAAGAGGCAGAGAGAATTGATCAAGCAAGAAAATCTCAACACCACAGCCTAC
ATCAATAGAGTAATGATGGCGAGCAATGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAACAAA
AAATTATACTAGATCAAGCAAAGGCGCTAGAGACCCAATATGTGCATAATGCGTTAAAAAGAAACCCTGT
GCCTAGAAACTACAATTACTACCAAGCGCCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTT
GATGATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTCAAC
CTGATGGGAAATTGAGCATGACTGATGCCGCCATTGATCCTAACATGACTAATTCAGGATTGAGATGGTA
TAGAGTTAATGAAATTGCAGAGAAGTTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTGATCAATAAA
GGCTATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGTGTGATTA
AAAAGCTCCCTCTTGTCAGAGATAAATAA
 Primer design