SecReT4
Protein ID: 15611546
T4SS name [ID]Cag [38]
Gene symbolorf17
Locus tagjhp0479
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]526781..527539 [-]
Productcag island protein
Component typeCagV
UniProt IDQ9ZLU7
KEGG IDhpj:jhp0479
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|15611546|ref|NP_223197.1| cag island protein [Helicobacter pylori J99]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMVLNVAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALNK
 
Nucleotide Sequence: 759 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c527539-526781 Helicobacter pylori J99 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAAGAAGTCTTGATTGATGAAAATTTGGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCAAAACTCAATAAGGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGTGCTCAATGT
CGCCGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAGAAAACAGATATATTTGTTTATGGCATTGAT
CGATACACAGGAGAATTTAAAATCGTCAAACGCTCCGATGCTAGGCAAATCGTCAATTCTGAAGCCGTTG
TGGATAGTGCAACTTCAAAATTTGTCTCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAA
GGATCAACTAATGCAGTATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTAGATAAAGTCCGAGCAGAAGCTATCATTAGCTCCAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACGCCTGATACAATGGAAAATTATGA
ATATATCACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAACCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACGGATTTACAAAACGAACAGACAGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAATAAATAA
 Primer design