SecReT4
Protein ID: 15611548
T4SS name [ID]Cag [38]
Gene symbolcagT
Locus tagjhp0481
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]528613..529455 [+]
Productcag island protein
Component typeCagT
UniProt IDQ9ZLU5
KEGG IDhpj:jhp0481
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7.8e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|15611548|ref|NP_223199.1| cag island protein [Helicobacter pylori J99]
MKLRASVLIGVAILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNNKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAKEEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|15611071|ref|NC_000921.1|:528613-529455 Helicobacter pylori J99 chromosome, complete genome
ATGAAACTGAGAGCAAGTGTTTTAATCGGTGTGGCAATTCTGTGCTTAATTTTAAGTGCGTGCAGTAACT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAGAAGTA
TAGTGAGATCCCCTTAAATGACAAACTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGACTATTTGTTGGATAATAAACAAGTTGTACTAACTTTCAAACTTGTTCACCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATCCTCCAATACAAGAATTACTTCCAAGCTAACGGGGCAAGATCTGA
CATTGATTTTTACTTGCAACCCACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTACAATGAT
AATCCCAACAACAAAGAAAAACCACAGACCTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAGACTCTCTTGCAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACATTGAGTAATCGTGCAGGTTATCAAATGAGGC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAAAGAAGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTGCGCAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design