SecReT4
Protein ID: 15611552
T4SS name [ID]Cag [38]
Gene symbolcagM
Locus tagjhp0485
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]532464..533594 [+]
Productcag island protein
Component typeCagM
UniProt IDQ9ZLU1
KEGG IDhpj:jhp0485
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|15611552|ref|NP_223203.1| cag island protein [Helicobacter pylori J99]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLVFRKQKIKE
LVDYRAKVLLDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNPLYKKLLPNPYAYVLNQETFT
QEDKERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNISN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVVSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|15611071|ref|NC_000921.1|:532464-533594 Helicobacter pylori J99 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCATTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAAGTGGCCGCAAAAGAAGACGCTCTTAAAGCTCG
CAAGAAGCTCTTAAACAATACGCATGATTTCTTAGAAGACTTGGTTTTTAGAAAACAAAAAATCAAAGAG
CTTGTGGATTACAGAGCTAAAGTTCTTTTAGATTTAGAAAACAAGTACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGTGATCTAGAGCAAGCCTTAAA
AGATAACCCTCTTTATAAGAAACTTCTTCCTAACCCTTATGCTTATGTTTTAAACCAAGAAACATTCACG
CAAGAAGATAAGGAGCGTTTGAGTTATTACTACCCCCAAGTGAAAACGAGCAGTATTTTTAAAAAAACTA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAGCAAAA
CAAAAAAGCGAGCCGATTAGCTTTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACATTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTGCAGCTTGAAAGAAACAAATTTGACTCCA
AAGCAAAAGATATTGCTCAAAAAGCCACCAACACGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATCAATGAGAAATACTTAAGGGGCTATGAAGCTTTTTCTAACTTGTTGAAAAATGTC
AAAGATGATGTGGAGTTGAATACTTTGACTAAAAACTTCACCAATCAAAAATTGAGTTTCGCACAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATCTTCGTAGATAGCGATCCTATGATGAGCGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGGTTTCTGCATACCGGAACAATGTTGCCAAGAATAACC
CCTTTGAATAG
 Primer design