SecReT4
Protein ID: 15611553
T4SS name [ID]Cag [38]
Gene symbolcagN
Locus tagjhp0486
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]533609..534529 [+]
Productcag island protein
Component typeCagN
UniProt IDQ9ZLU0
KEGG IDhpj:jhp0486
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|15611553|ref|NP_223204.1| cag island protein [Helicobacter pylori J99]
MKSIFKKLGSVALYSLVVYGGLNAINTALLPSEYKELVALGFKKIKTLYQRHDDKEITKEEKEFATNALR
EKLRNDRARVEQIQKNIEAFEKKNNSSVQKKAAKHRGLQELNEINANPLNDNPNGNSSTETKSNKDDNFD
EMINKVNESFVKPAAPLVPDEWRTPEIEIIINECIISSNDYDGLRKCLIKGIKDQKILAPLLEKIQEIET
ENNKFSRQHLSGLKLALNNSDNRTFLIASCAICEKRKKEMEQENNYQDTTNASEFGTTDTKENEAKDATF
SNNRSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|15611071|ref|NC_000921.1|:533609-534529 Helicobacter pylori J99 chromosome, complete genome
TTGAAAAGTATCTTCAAAAAACTAGGTTCTGTCGCTCTTTATTCTTTGGTTGTTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTACCGAGTGAATACAAAGAATTGGTGGCTTTAGGCTTTAAAAAAATCAAAAC
ACTCTATCAAAGACATGACGACAAAGAAATTACAAAAGAGGAAAAAGAATTCGCCACTAACGCTTTGAGA
GAAAAATTACGGAATGATAGGGCGAGAGTAGAGCAAATTCAAAAGAATATTGAAGCGTTTGAAAAAAAGA
ACAACTCTTCTGTTCAAAAAAAAGCGGCTAAGCACAGAGGATTGCAAGAATTAAACGAAATTAACGCTAA
CCCTTTGAATGACAACCCTAATGGCAATTCTTCCACTGAAACCAAATCTAATAAAGATGATAATTTTGAT
GAGATGATCAATAAGGTGAATGAATCTTTTGTGAAACCTGCTGCTCCGCTTGTACCTGATGAGTGGAGAA
CGCCTGAAATTGAAATCATTATCAATGAGTGTATTATTTCAAGCAACGATTACGATGGGTTAAGAAAGTG
TTTGATCAAAGGCATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATTCAAGAAATAGAGACA
GAAAATAACAAGTTTTCTAGACAACACCTGAGTGGTTTAAAACTCGCTCTCAATAACAGCGACAATAGAA
CCTTTCTTATAGCTTCGTGCGCTATTTGTGAGAAGAGAAAAAAAGAAATGGAGCAAGAAAATAACTACCA
AGATACTACAAATGCAAGTGAGTTTGGCACTACTGATACAAAAGAAAATGAAGCAAAAGATGCAACATTC
TCAAACAATCGCTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCGCTCATG
GAAAAAAATAG
 Primer design