SecReT4
Protein ID: 15611554
T4SS name [ID]Cag [38]
Gene symbolcagL
Locus tagjhp0487
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]534611..535324 [-]
Productcag island protein
Component typeCagL
UniProt IDQ9ZLT9
KEGG IDhpj:jhp0487
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|15611554|ref|NP_223205.1| cag island protein [Helicobacter pylori J99]
MKTLVKNTIYSFLLLSVLMAEDITSGLKQLDNTYQETNQQVLKNLDEIFSTTSPSANNKIGQEDALNIKK
AAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQKTAEQQCGISDKVLVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIKKLMLAHNKVFLNYLEE
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c535324-534611 Helicobacter pylori J99 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCATATATTCTTTTTTGCTATTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGCTTAAAGCAACTGGATAACACCTACCAAGAGACCAACCAACAAGTGCTCAAAAACCTAGATGA
GATTTTTTCAACCACTAGCCCTAGCGCTAATAATAAAATAGGTCAAGAAGATGCTCTAAACATCAAAAAA
GCGGCCATTGCTTTGAGAGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTTAAGACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAAGACTGCTGAGCAACAATGCGGAATATCCGATAAAGTTTTAGTTCTTTATTGTGAG
GGGAAGCTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCTCTAAAGGCATATC
AGAGCAACATTGGAGGTACAGCTTCCTTAATCACTGCTTCACAGACGCTTGTAGAAAGCCTAAAAAATAA
AAATTTCATCAAAGGAATCAAAAAGCTTATGTTAGCTCACAACAAGGTCTTTTTAAATTATTTAGAGGAG
TTGGACGCATTAGAAAGATCCCTAGAACAAAGTAAGCGACAATACCTACAAGAAAGGCAATCAAGTAAGA
TCATTGTTAAATGA
 Primer design