SecReT4
Protein ID: 15611557
T4SS name [ID]Cag [38]
Gene symbolcagG
Locus tagjhp0490
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]537606..538034 [-]
Productcag island protein
Component typeCagG
UniProt IDQ9ZLT6
KEGG IDhpj:jhp0490
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|15611557|ref|NP_223208.1| cag island protein [Helicobacter pylori J99]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAIL
NDYNDKNVNIKFDDISLGSFQPNDNLGINAMWGIQNLLMSQMMSNYGPNNSFMYGYAPTYSDSSFLPPIL
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c538034-537606 Helicobacter pylori J99 chromosome, complete genome
ATGAAAACGAACTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CGCTTAACGCTGACCAAAACACGGATATAAAAGATATTAGTCCTGAAGATATGGCGCTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAGCTAAAAATAGAGATCCCTAAAGAAACCCTAGAGCAAAAAGTGGCCATACTC
AATGACTATAATGATAAGAATGTTAATATCAAGTTTGACGACATAAGTTTAGGGAGTTTCCAACCTAATG
ATAATCTAGGTATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGAGCAATTACGG
TCCAAACAATTCTTTCATGTATGGCTATGCGCCAACATACTCAGATTCATCGTTTTTACCACCGATCTTA
GGGTATTAA
 Primer design