SecReT4
Protein ID: 15611560
T4SS name [ID]Cag [38]
Gene symbolcagD
Locus tagjhp0493
StrainHelicobacter pylori J99
Repliconchromosome [GenBank: NC_000921] [Browse all T4SS(s) in this replicon]
Location [Strand]541857..542483 [-]
Productcag island protein
Component typeCagD
UniProt IDQ9ZLT3
KEGG IDhpj:jhp0493
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|15611560|ref|NP_223211.1| cag island protein [Helicobacter pylori J99]
MINNNNNNKKLRGFFLKVLLSLVVFSSYGSANDDKEAKKEALEKEKNTPNGLVYTNLDFDSFKATIKNLK
DKKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPVIEKIFDEKGKEMGLNVELQINPEVKDFFTF
KSISTTNKQRCFLSLHGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTIESLKKIFYTITCEAVYL
 
Nucleotide Sequence: 627 bp     [Download]
>gi|15611071|ref|NC_000921.1|:c542483-541857 Helicobacter pylori J99 chromosome, complete genome
TTGATCAACAATAATAATAACAATAAAAAACTGAGAGGCTTTTTTTTGAAAGTTCTCTTAAGTCTCGTTG
TTTTCAGTTCGTATGGGTCAGCAAATGACGATAAAGAAGCCAAAAAAGAAGCGCTAGAAAAAGAAAAAAA
CACTCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTTAAAGCGACTATCAAAAATTTGAAA
GACAAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAGATGAAGTTTTTGACTTCGTGATTG
TCAATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCCAGTTATTGAAAAAATCTTTGATGA
AAAGGGTAAAGAAATGGGATTGAATGTAGAATTACAGATCAATCCTGAAGTGAAAGACTTTTTTACTTTC
AAAAGCATCAGCACGACCAACAAACAACGCTGCTTTCTATCATTGCACGGAGAAACAAGAGAAATTTTAT
GCGATGATAAGCTATATAATGTTTTATTGGCCGTATTCAATTCTTATGATCCTAATGATCTTTTGAAACA
CATTAGCACCATAGAGTCTCTCAAAAAAATCTTTTATACGATTACATGTGAAGCGGTATATCTATAA
 Primer design