SecReT4
Protein ID: 15645148
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0522
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]548134..549579 [+]
Productcag pathogenicity island protein (cag3)
Component typeCagdelta
UniProt IDO25258
KEGG IDhpy:HP0522
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|15645148|ref|NP_207318.1| cag pathogenicity island protein (cag3) [Helicobacter pylori 26695]
MFRKLATAVSLIGLLTSNTLYAKEISEADKVIKATKETKETKKEAKRLKKEAKQRQQIPDHKKPQYVSVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLRVPKRSDPNAHTLDKGASIDENKLFEQQKKM
YFNYANDVICRPDDEVCSPLRDEMVAMPTSDSVTQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPEN
SKEKLIEELIANSQLVANEEEREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVE
VPVSPQTSNSDETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKTPLNPNDLRSLEEEIKSYY
IKSNGLCYTNGINLYVKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKDSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|15644634|ref|NC_000915.1|:548134-549579 Helicobacter pylori 26695 chromosome, complete genome
ATGTTTAGAAAACTAGCAACCGCTGTATCGCTCATAGGCTTACTAACCTCTAACACTCTTTATGCTAAAG
AAATAAGTGAAGCCGATAAGGTCATTAAGGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGCTAAACG
ACTCAAAAAAGAAGCTAAACAGCGCCAACAGATCCCTGATCATAAGAAACCTCAATATGTCTCTGTTGAT
GACACAAAAACTCAAGCGCTGTTTGATATATACGACACCTTGAATGTGAATGACAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACCTATCTCTACGCTATGGATCTATTGGATTACAACAACTA
TTTATCCATAGAAAACCCCATTATCAAAACAAGAGCAATGGGAACTTATGCGGATTTGATTATCATCACA
GGCTCATTAGAGCAAGTCAATGGGTATTACAACATTCTAAAAGCGCTCAACAAACGCAACGCTAAGTTTG
TGTTAAAAATCAATGAGAACATGCCTTATGCCCAAGCGACTTTTTTAAGAGTGCCAAAAAGAAGCGATCC
TAATGCCCACACGCTTGATAAGGGAGCGTCAATTGATGAGAATAAGCTTTTTGAACAACAAAAGAAAATG
TATTTCAATTACGCTAACGATGTGATCTGCAGACCCGATGATGAAGTGTGTTCGCCCCTAAGAGATGAGA
TGGTAGCTATGCCCACTAGCGATAGCGTTACTCAAAAACCCAATATCATTGCTCCTTATAGCTTGTATAG
ACTAAAAGAGACAAATAACGCCAATGAGGCCCAACCATCACCTTATGCCACTCAAACCGCTCCCGAAAAC
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCTAACTCCCAACTCGTAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGGCTGAATTGGCTAAATATAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTTTAGAAGCAGAGTTGAAAAAGAAAAACGCTAAGAAACCTAGAGTAGTGGAA
GTGCCTGTTTCTCCTCAAACAAGTAATTCTGATGAAACAATGAGAGTTGTCAAAGAAAAAGAGAACTATA
ATGGGTTATTAGTGGATAAGGAGACCACGATCAAAAGAAGCTATGAGGGGACTTTGATCAGTGAAAATTC
TTACAGCAAAAAAACACCTCTCAACCCTAATGACTTGAGGAGCTTAGAAGAAGAAATTAAGAGCTACTAT
ATCAAGTCTAATGGCTTGTGTTATACTAATGGCATTAACCTCTATGTAAAAATCAAAAACGACCCCTATA
AAGAGGGAATGCTGTGTGGTTATGAGAGCGTTCAAAATCTGCTCTCACCTCTAAAGGACAAGCTCAAATA
CGACAAACAAAAGTTACAAAAAGCGTTACTGAAAGATTCAAAGTAA
 Primer design