SecReT4
Protein ID: 15645150
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0524
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]550217..552463 [-]
Productcag pathogenicity island protein (cag5)
Component typeCagbeta
Also Known asVirD4
UniProt IDO25260
KEGG IDhpy:HP0524
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.6e-180, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.6e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.8e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|15645150|ref|NP_207320.1| cag pathogenicity island protein (cag5) [Helicobacter pylori 26695]
MEDFLYNTLYFIEDYKLVVIFSFIGLIALFFLYKFIKAQKKAFKDKANQPQKKKSFKEIIIDGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNRSPESDDDLFDIWIYAIQDFPNYYFKALGFSSLKIYG
FNISLVVYGSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRAF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRVLSPATRNMWNSFKTMGGARETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDEVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPNQATFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|15644634|ref|NC_000915.1|:c552463-550217 Helicobacter pylori 26695 chromosome, complete genome
ATGGAAGACTTTTTGTATAACACCTTATATTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTTCTTTACAAATTCATAAAAGCTCAAAAAAAGGCTTTTAAAGATAAAGC
TAACCAGCCTCAAAAGAAAAAAAGCTTTAAAGAAATCATTATAGATGGGCTGAAAGAAAGGGTTAAAACC
TTTGGCTTTTGGTTGCAAGCTATACTATTACTATCCTATTCTTTTATCACATCAGGATTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGATGATAATCGATCGCCTGAGAGCGATGATGATCTTTTTGATATATGGAT
CTATGCGATACAAGATTTTCCTAATTACTATTTTAAAGCGCTTGGTTTTAGTTCACTCAAGATTTATGGG
TTCAATATATCCTTAGTCGTATATGGTTCTATTTTATGCTCTTATATCTTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGAGATATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGTAGCGC
GAGTTGGGAAACTGAAGAGAAAATGATCAAAGCCAAACTCATCACGCCCAACAATAAAAAACGCGCCTTT
GACAAACGAGAGGTGATTGTAGGCAGGCGTGGCTTGGGGGATTTTATCGCTTACGCAGGGCAGGCGTTCA
TTGGCTTGATTGCTCCTACTAGAAGCGGTAAGGGGGTGGGTTTCATCATGCCCAATATGATCAATTATCC
TCAAAATATCGTTGTGTTTGACCCTAAAGCTGACACTATGGAGACTTGCGGAAAAATCAGAGAAAAACGC
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAATGATGTGGTTTTGACCGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGCATGGTGGCTAGTGGAGGGGATTTTTCCACTCAAATCTTTGGATTAGCAAAGCTCGTGTTCCCTGAA
AGACCTAATGAAAAAGATCCTTTCTTTAGCAATCAAGCGCGAAATCTTTTTGTCATCAATTGCAATATTT
ACAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
ACCCACGATGTTTTTCATAGGTTCTATGGCAAGCGGGATCAACTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTTTAATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGATAATCTAAGAGTGCTTA
GTCCTGCCACTAGAAACATGTGGAATAGCTTCAAGACAATGGGCGGCGCTAGAGAAACTTATAGCTCGGT
TCAAGGGGTATACACTTCAGCCTTTGCGCCTTATAATAACGCAATGATTAGAAATTTCACGAGCGCCAAT
GATTTTGATTTCAGGCGTTTAAGGATCGATGAAGTGAGTATTGGTGTGATCGCTAATCCTAAAGAAAGCA
CTATTGTTGGACCGATATTAGAGCTGTTTTTCAATGTGATGATTTATAGCAATTTGATTCTGCCAATCCA
TGATCCACAGTGCAAAAGAAGTTGCTTGATGCTCATGGACGAATTCACTTTATGTGGCTATTTAGAGACC
TTTGTTAAAGCGGTAGGGATTATGGCAGAATACAACATGCGCCCCGCTTTTGTGTTTCAAAGTAAGGCGC
AACTAGAGAATGACCCCCCACTTGGTTATGGTAGGAATGGCGCTAAGACTATTTTAGACAACCTTTCTTT
GAATATGTATTATGGGATTAACAACGATAACTACTATGAACATTTTGAAAAACTTTCTAAGGTATTAGGG
AAATACACAAGGCAAGACGTGAGCCGAAGCATTGATGATAATACAGGTAAGACCAACACTTCTATCAGCA
ACAAAGAGCGGTTTTTGATGACCCCTGATGAATTGATGACTATGGGCGATGAGCTTATCATTCTAGAGAA
TACGCTCAAACCTATCAAGTGCCACAAGGCGCTTTACTATGATGATCCATTCTTCACCGATGAACTCATT
AAGGTAAGTCCAAGCTTGAGCAAGAAATACAAATTGGGGAAAGTGCCTAATCAAGCAACTTTCTATGATG
ATTTGCAAGCCGCTAAAACTAGAGGTGAATTGAGTTATGATAAATCTTTAGTGCCTGTGGGTTCAAGTGA
ACTGTGA
 Primer design