SecReT4
Protein ID: 15645153
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0527
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]554206..559989 [-]
Productcag pathogenicity island protein (cag7)
Component typeCagY
UniProt IDO25262
KEGG IDhpy:HP0527
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 0, Aligned region: 439..465
CagY_M [PF07337], Evalue: 0, Aligned region: 473..500
CagY_M [PF07337], Evalue: 0, Aligned region: 510..538
CagY_M [PF07337], Evalue: 0, Aligned region: 552..584
CagY_M [PF07337], Evalue: 0, Aligned region: 585..615
CagY_M [PF07337], Evalue: 0, Aligned region: 621..653
CagY_M [PF07337], Evalue: 0, Aligned region: 655..678
CagY_M [PF07337], Evalue: 0, Aligned region: 690..722
CagY_M [PF07337], Evalue: 0, Aligned region: 729..761
CagY_M [PF07337], Evalue: 0, Aligned region: 767..799
CagY_M [PF07337], Evalue: 0, Aligned region: 800..828
CagY_M [PF07337], Evalue: 0, Aligned region: 836..868
CagY_M [PF07337], Evalue: 0, Aligned region: 874..906
CagY_M [PF07337], Evalue: 0, Aligned region: 913..945
CagY_M [PF07337], Evalue: 0, Aligned region: 951..983
CagY_M [PF07337], Evalue: 0, Aligned region: 984..1012
CagY_M [PF07337], Evalue: 0, Aligned region: 1020..1052
CagY_M [PF07337], Evalue: 0, Aligned region: 1058..1090
CagY_M [PF07337], Evalue: 0, Aligned region: 1096..1128
CagY_M [PF07337], Evalue: 0, Aligned region: 1130..1157
CagY_M [PF07337], Evalue: 0, Aligned region: 1165..1197
CagY_M [PF07337], Evalue: 0, Aligned region: 1203..1235
CagY_M [PF07337], Evalue: 0, Aligned region: 1242..1273
CagY_M [PF07337], Evalue: 0, Aligned region: 1276..1305
CagY_M [PF07337], Evalue: 0, Aligned region: 1311..1343
CagY_M [PF07337], Evalue: 0, Aligned region: 1350..1381
CagY_M [PF07337], Evalue: 0, Aligned region: 1389..1423
CagY_M [PF07337], Evalue: 0, Aligned region: 1428..1455
CagY_M [PF07337], Evalue: 0, Aligned region: 1477..1511
TrbI [PF03743], Evalue: 5.9e-36, Aligned region: 1691..1887
Protein Sequence: 1927 a.a.     [Download]
>gi|15645153|ref|NP_207323.1| cag pathogenicity island protein (cag7) [Helicobacter pylori 26695]
MNEENDKLETSKKAQQDSPQDLSNEEATEANHFENLLKESKESSDHHLDNPTETQTHFDGDKSEETQTQM
DSEGNETSESSNGSLADKLFKKARKLVDNKKPFTQQKNLDEETQELNEEDDQENNEYQEETQTDLIDDET
SKKTQQHSPQDLSNEEATEANHFENLLKESKESSDHHLDNPTETQTNFDGDKSEETQTQMDSEGNETSES
SNGSLADKLFKKARKLVDNKKPFTQQKNLDEETQELNEEDDQENNEYQEETQTDLIDDETSKKTQQHSPQ
DLSNEEATEANHFENLLKESKESSDHHLDNPTETQTNFDGDKSEEITDDSNDQEIIKGSKKKYIIGGIVV
AVLIVIILFSRSIFHYFMPLEDKSSRFSKDRNLYVNDEIQIRQEYNRLLKERNEKGNMIDKNLFFNDDPN
RTLYNYLNIAEIEDKNPLRAFYECISNGGNYEECLKLIKDKKLQDQMKKTLEAYNDCIKNAKTEEERIKC
LDLIKDENLKKSLLNQQKVQVALDCLKNAKTDEERNECLKLINDPEIREKFRKELELQKELQEYKDCIKN
AKTEAEKNKCLKGLSKEAIERLKQQALDCLKNAKTDEERNECLKNIPQDLQKELLADMSVKAYKDCVSKA
RNEKEKQECEKLLTPEARKKLEQQVLDCLKNAKTDEERKKCLKDLPKDLQSDILAKESLKAYKDCVSQAK
TEAEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEAEKKECEKLLTPEAKKKLEEAKKSVKAYL
DCVSRARNEKEKKECEKLLTPEAKKLLEQQALDCLKNAKTDKERKKCLKDLPKDLQKKVLAKESVKAYLD
CVSQAKTEAEKKECEKLLTPEARKLLEEAKKSVKAYLDCVSQAKTEAEKKECEKLLTPEARKLLEEXAKE
SVKAYLDCVSQAKNEAEKKECEKLLTLESKKKLEEAKKSVKAYLDCVSQAKTEAEKKECEKLLTPEAKKL
LEQQALDCLKNAKTEADKKRCVKDLPKDLQKKVLAKESLKAYKDCVSKARNEKEKKECEKLLTPEAKKLL
EEAKKSVKAYLDCVSQAKTEAEKKECEKLLTPEARKLLEEAKESVKAYKDCVSKARNEKEKKECEKLLTP
EAKKLLEQQVLDCLKNAKTEADKKRCVKDLPKDLQKKVLAKESVKAYLDCVSRARNEKEKKECEKLLTPE
AKKLLEEAKESLKAYKDCLSQARNEEERRACEKLLTPEARKLLEQEVKKSIKAYLDCVSRARNEKEKKEC
EKLLTPEARKFLAKQVLNCLEKAGNEEERKACLKNLPKDLQENILAKESLKAYKDCLSQARNEEERRACE
KLLTPEARKLLEQEVKKSVKAYLDCVSRARNEKEKKECEKLLTPEARKFLAKELQQKDKAIKDCLKNADP
NDRAAIMKCLDGLSDEEKLKYLQEAREKAVADCLAMAKTDEEKRKCQNLYSDLIQEIQNKRTQNKQNQLS
KTERLHQASECLDNLDDPTDQEAIEQCLEGLSDSERALILGIKRQADEVDLIYSDLRNRKTFDNMAAKGY
PLLPMDFKNGGDIATINATNVDADKIASDNPIYASIEPDIAKQYETEKTIKDKNLEAKLAKALGGNKKDD
DKEKSKKSTAEAKAENNKIDKDVAETAKNISEIALKNKKEKSGEFVDENGNPIDDKKKAEKQDETSPVKQ
AFIGKSDPTFVLAQYTPIEITLTSKVDATLTGIVSGVVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTP
IMTRLMIVFTKAITPDGVIIPLANAQAAGMLGEAGVDGYVNNHFMKRIGFAVIASVVNSFLQTAPIIALD
KLIGLGKGRSERTPEFNYALGQAINGSMQSSAQMSNQILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGV
YDVKITNKSVVDEIIKQSTKTLSREHEEITTSPKGGN
 
Nucleotide Sequence: 5784 bp     [Download]
>gi|15644634|ref|NC_000915.1|:c559989-554206 Helicobacter pylori 26695 chromosome, complete genome
ATGAATGAAGAAAACGATAAACTTGAAACTTCTAAAAAAGCCCAACAAGATTCACCCCAAGATTTATCCA
ATGAAGAAGCAACAGAAGCCAATCATTTTGAAAATCTTTTAAAAGAATCCAAAGAAAGCTCAGATCATCA
TCTTGACAACCCCACAGAAACTCAAACCCATTTTGATGGAGACAAGTCAGAAGAAACCCAAACTCAAATG
GATTCTGAAGGTAATGAAACTTCAGAATCTAGCAATGGCAGTCTAGCAGACAAGTTATTCAAAAAAGCCA
GAAAATTAGTTGATAATAAAAAACCTTTCACTCAGCAAAAGAATTTAGATGAAGAAACCCAAGAACTGAA
CGAAGAAGACGATCAAGAAAATAATGAGTATCAAGAAGAAACTCAAACGGACTTAATTGATGATGAAACT
TCTAAAAAAACCCAACAACATTCACCCCAAGATTTATCCAATGAAGAAGCAACAGAAGCCAATCATTTTG
AAAATCTTTTAAAAGAATCCAAAGAAAGCTCAGATCATCATCTTGACAACCCCACAGAAACTCAAACCAA
TTTTGATGGAGACAAGTCAGAAGAAACCCAAACTCAAATGGATTCTGAAGGTAATGAAACTTCAGAATCT
AGCAATGGCAGTCTAGCAGACAAGTTATTCAAAAAAGCCAGAAAATTAGTTGATAATAAAAAACCTTTCA
CTCAGCAAAAGAATTTAGATGAAGAAACCCAAGAACTGAACGAAGAAGACGATCAAGAAAATAATGAGTA
TCAAGAAGAAACTCAAACGGACTTAATTGATGATGAAACTTCTAAAAAAACCCAACAACATTCACCCCAA
GATTTATCCAATGAAGAAGCAACAGAAGCCAATCATTTTGAAAATCTTTTAAAAGAATCCAAAGAAAGCT
CAGATCATCATCTTGACAACCCCACAGAAACTCAAACCAATTTTGATGGAGACAAGTCAGAAGAAATAAC
TGACGACTCTAACGATCAAGAGATTATCAAAGGAAGCAAAAAGAAATATATTATTGGTGGCATTGTAGTC
GCTGTTCTTATCGTGATTATTTTATTTTCTAGAAGCATTTTTCACTACTTCATGCCTTTGGAAGATAAAA
GCTCTCGTTTTAGCAAAGACAGGAATCTTTATGTCAATGATGAAATCCAAATAAGGCAAGAGTATAACCG
ATTGCTGAAAGAACGGAATGAAAAAGGCAATATGATCGATAAGAATCTTTTCTTCAATGACGATCCCAAT
AGAACCTTATACAACTATTTGAATATTGCAGAAATTGAGGACAAAAACCCGTTGAGAGCCTTTTATGAAT
GTATTAGTAATGGTGGCAACTATGAAGAATGTTTGAAGCTTATCAAAGACAAAAAACTTCAAGATCAGAT
GAAAAAGACTCTAGAGGCTTATAACGACTGCATCAAAAATGCCAAAACTGAAGAAGAAAGGATCAAGTGT
TTAGATTTAATCAAAGATGAAAACCTAAAAAAAAGCTTACTGAACCAACAAAAAGTTCAAGTGGCGCTAG
ATTGTTTGAAAAACGCTAAAACCGATGAAGAACGAAACGAGTGCCTAAAACTCATAAATGACCCTGAGAT
TAGAGAGAAATTCCGTAAGGAATTAGAGCTTCAAAAAGAGCTTCAAGAGTATAAGGATTGTATCAAAAAC
GCCAAAACAGAAGCTGAGAAAAACAAATGCTTGAAAGGCTTGTCTAAAGAAGCTATAGAGAGATTGAAAC
AGCAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGAAACGAGTGCTTGAAAAATATTCC
CCAAGACTTGCAAAAAGAACTATTAGCTGATATGAGCGTCAAGGCTTACAAGGATTGCGTATCAAAAGCT
AGAAATGAAAAAGAGAAACAAGAATGCGAGAAATTGCTCACGCCTGAAGCGAGGAAAAAGTTAGAACAAC
AGGTTCTAGATTGTTTGAAAAACGCTAAAACCGATGAAGAACGAAAAAAGTGTTTGAAAGATCTCCCTAA
AGACTTACAAAGCGATATTCTAGCCAAAGAGAGCCTGAAAGCTTATAAAGACTGCGTATCTCAAGCCAAA
ACCGAAGCTGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAAAAAACTTTTAGAAGAAGAAG
CCAAAGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAACCGAAGCTGAGAAAAAAGAATG
CGAGAAATTGCTCACCCCTGAAGCGAAAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAAGCTTACTTG
GATTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGA
AAAAACTTTTAGAGCAACAAGCACTAGATTGTTTGAAAAACGCTAAAACCGATAAAGAACGAAAAAAGTG
TTTGAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCTAAAGAAAGCGTTAAAGCTTACTTGGAT
TGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAGAA
AACTTTTAGAAGAAGCTAAAAAAAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAACTGAAGC
TGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAGAAAACTTTTAGAAGAAGAMGCCAAAGAG
AGCGTTAAAGCTTACTTGGATTGCGTATCTCAAGCCAAAAACGAAGCTGAGAAAAAAGAATGCGAGAAAT
TGCTCACCCTTGAATCGAAAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAGGCTTATTTGGATTGCGT
ATCTCAAGCCAAAACCGAAGCTGAGAAAAAAGAATGCGAAAAATTGCTCACGCCTGAAGCGAAAAAACTT
TTAGAGCAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGAAGCTGATAAAAAAAGGTGTGTCAAAG
ATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCCAAAGAGAGCCTGAAAGCTTATAAAGACTGCGTATC
AAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAAAAAACTTTTA
GAAGAAGCTAAAAAAAGCGTTAAGGCTTACTTGGATTGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAA
AAGAATGCGAGAAATTACTCACCCCTGAAGCGAGAAAACTCTTAGAAGAAGCTAAAGAGAGCGTTAAAGC
TTATAAAGACTGCGTATCAAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACGCCT
GAAGCGAAAAAACTTTTAGAGCAACAAGTGCTAGATTGTTTGAAAAACGCTAAAACCGAAGCTGATAAAA
AAAGGTGTGTCAAAGATCTCCCTAAAGACTTGCAGAAAAAGGTTTTAGCTAAAGAGAGCGTTAAGGCTTA
TTTGGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTGCTCACCCCTGAA
GCGAAAAAACTTTTAGAAGAAGCCAAAGAGAGTCTTAAAGCTTATAAAGACTGCCTCTCTCAAGCTAGAA
ATGAAGAAGAAAGGAGAGCTTGCGAGAAACTACTCACGCCTGAAGCGAGAAAACTCTTAGAGCAAGAAGT
TAAGAAAAGCATTAAGGCTTATTTGGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAATGC
GAGAAATTACTCACGCCTGAAGCGAGAAAATTTTTAGCGAAGCAAGTGCTAAATTGTTTGGAAAAAGCTG
GAAATGAAGAAGAAAGAAAAGCATGTCTTAAAAATCTCCCTAAAGACTTACAGGAAAATATTTTAGCTAA
AGAGAGTCTTAAAGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAAGAAAGGAGAGCTTGCGAG
AAACTACTCACGCCTGAAGCGAGAAAACTCTTAGAGCAAGAAGTTAAGAAAAGCGTTAAGGCTTATTTGG
ACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAG
AAAATTTTTAGCGAAAGAACTCCAACAAAAAGATAAAGCGATCAAAGATTGCTTGAAAAACGCCGATCCT
AACGACAGAGCGGCTATCATGAAGTGTTTGGATGGTTTGAGCGATGAAGAGAAGCTCAAATACCTGCAAG
AAGCTAGAGAAAAGGCTGTTGCGGATTGTTTGGCTATGGCTAAAACCGATGAAGAAAAAAGGAAATGCCA
AAACCTTTATAGCGATTTGATCCAAGAAATCCAAAATAAAAGGACACAAAACAAACAAAATCAATTGAGT
AAAACAGAAAGGTTGCATCAAGCAAGCGAGTGCTTGGATAACTTAGATGACCCTACTGATCAAGAGGCCA
TAGAGCAATGTTTAGAGGGCTTGAGCGATAGTGAAAGGGCGCTAATTCTAGGAATTAAACGACAAGCTGA
TGAAGTGGATCTGATTTATAGCGATCTAAGAAACCGTAAAACCTTTGATAACATGGCGGCTAAAGGTTAT
CCATTGTTACCAATGGATTTCAAAAATGGCGGCGATATTGCCACTATTAACGCCACTAATGTTGATGCGG
ACAAAATAGCTAGCGATAATCCTATTTATGCTTCCATAGAGCCTGATATTGCCAAGCAATACGAAACAGA
AAAAACCATTAAGGATAAGAATTTAGAAGCTAAATTAGCTAAGGCTTTAGGTGGCAATAAAAAAGATGAC
GATAAAGAAAAAAGTAAAAAATCCACAGCAGAAGCTAAAGCAGAAAACAATAAGATAGACAAAGATGTCG
CAGAAACTGCCAAGAATATCAGTGAAATCGCTCTTAAGAACAAAAAAGAAAAGAGTGGGGAATTTGTAGA
TGAAAATGGTAATCCCATTGATGACAAAAAGAAAGCAGAAAAACAAGATGAAACAAGCCCTGTCAAACAG
GCCTTTATAGGCAAGAGTGATCCCACATTTGTTTTAGCGCAATACACCCCCATTGAAATCACTCTGACTT
CTAAAGTAGATGCCACTCTCACAGGTATAGTGAGTGGGGTTGTAGCCAAAGATGTATGGAACATGAACGG
CACTATGATCTTATTAGACAAAGGCACTAAGGTGTATGGGAATTATCAAAGCGTGAAAGGTGGCACACCC
ATTATGACACGCTTAATGATAGTCTTTACTAAAGCCATTACGCCTGATGGTGTGATAATACCTCTAGCAA
ACGCTCAAGCAGCAGGCATGTTGGGTGAAGCAGGGGTAGATGGCTATGTGAATAATCACTTTATGAAGCG
CATAGGCTTTGCTGTGATAGCAAGCGTGGTTAATAGCTTCTTGCAAACTGCGCCTATCATAGCTCTAGAT
AAACTCATAGGCCTTGGCAAAGGTAGAAGTGAAAGGACACCTGAATTTAATTACGCTTTGGGTCAAGCTA
TCAATGGTAGCATGCAAAGTTCAGCTCAGATGTCTAATCAAATTCTAGGGCAACTGATGAATATCCCCCC
AAGTTTTTACAAAAACGAGGGCGATAGTATTAAGATTCTCACAATGGACGATATTGATTTTAGCGGTGTG
TATGATGTTAAAATTACTAACAAATCTGTGGTAGATGAAATTATCAAACAAAGCACCAAAACTTTGTCTA
GAGAACATGAAGAAATCACCACAAGCCCCAAAGGTGGCAATTAA
 Primer design