SecReT4
Protein ID: 15645154
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0528
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]560004..561572 [-]
Productcag pathogenicity island protein (cag8)
Component typeCagX
UniProt IDO25263
KEGG IDhpy:HP0528
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-38, Aligned region: 55..171
CagX [PF03524], Evalue: 3.1e-38, Aligned region: 259..490
Protein Sequence: 522 a.a.     [Download]
>gi|15645154|ref|NP_207324.1| cag pathogenicity island protein (cag8) [Helicobacter pylori 26695]
MGQAFFKKIVGCFCLGYLFLSSAIEAAALDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLE
KDETISYITTGFNKGWSIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKE
LEEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSEFIKQQRENE
LDQMERLEDMQEQAQANALKQIEELNKKQAEETIKQRAKDKINIKTDKPQKSPEDNSIELSPSDSAWRTN
LVVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQKELIKQENLNTTAY
INRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIF
DDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKDKALVTVINK
GYGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|15644634|ref|NC_000915.1|:c561572-560004 Helicobacter pylori 26695 chromosome, complete genome
ATGGGGCAGGCATTTTTTAAAAAAATTGTTGGCTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGCAA
TAGAAGCAGCAGCACTTGACATTAAGAATTTTAATCGTGGTAGGGTGAAAGTGGTGAATAAGAAGATTGC
TTATTTGGGAGATGAAAAACCTATTACGATTTGGACTTCATTAGACAATGTTACCGTGATCCAACTTGAA
AAAGATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAGTATTGTGCCTAATTCTAATC
ATATATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCCCT
AATGACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCGCCTGACCCTAAAGAA
TTAGAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAAGCGCAAAAAGCACAAAAAG
ATAAAAGAGAAAAAAGAAAAGAAGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTAT
GAGTAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTTATCAAGCAACAACGAGAAAATGAA
TTAGACCAAATGGAACGACTAGAGGACATGCAAGAACAGGCTCAAGCTAATGCGCTCAAACAAATTGAAG
AACTCAACAAGAAACAAGCTGAAGAGACAATCAAGCAAAGAGCCAAAGATAAAATCAATATTAAGACAGA
TAAGCCTCAAAAAAGCCCTGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGAACTAAT
CTTGTTGTGCGGACTAATAAAGCCTTGTATCAATTCATTTTGAGAATAGCTCAAAAAGACAATTTTGCTT
CAGCGTATCTAACAGTCAAATTAGAATACCCACAAAGACACGAAGTCTCTAGCGTTATTGAAGAGGAGTT
AAAAAAGAGAGAAGAAGCAAAGAGGCAGAAAGAATTGATTAAGCAAGAAAATCTTAACACCACAGCCTAC
ATCAATAGAGTGATGATGGCGAGCAATGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAGCAAA
AAATTATCTTAGATCAAGCAAAGGCGCTAGAGACTCAATATGTGCATAATGCCTTAAAAAGAAACCCCGT
GCCTAGAAACTACAACTACTACCAAGCGCCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTT
GATGATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTCAAC
CTGATGGGAAATTGAGCATGACTGATGCCGCCATTGATCCTAACATGACCAATTCAGGATTGAGATGGTA
TAGAGTTAATGAAATTGCAGAAAAATTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTAATCAATAAA
GGCTATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGTGTGATTA
AAAAGCTCCCTCTTGTCAGAGATAAATAA
 Primer design