SecReT4
Protein ID: 15645156
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0530
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]563237..563995 [-]
Productcag pathogenicity island protein (cag10)
Component typeCagV
UniProt IDO25265
KEGG IDhpy:HP0530
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.8e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|15645156|ref|NP_207326.1| cag pathogenicity island protein (cag10) [Helicobacter pylori 26695]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNVAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIREVESKNKALNK
 
Nucleotide Sequence: 759 bp     [Download]
>gi|15644634|ref|NC_000915.1|:c563995-563237 Helicobacter pylori 26695 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAAGAAGTCTTGATTGATGAAAATTTGGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCAAAACTCAATAAGGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGCACTCAATGT
CGCCGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAGAAAACGGATATATTTGTTTATGGCATTGAT
CGATACACAGGAGAATTTAAAATTGTCAAACGCTCCGATGCTAGGCAAATCGTCAATTCTGAAGCCGTTG
TGGATAGTGCAACTTCAAAATTTGTATCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAA
GGATCAACTAATGCAGTATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTAGATAAAGTCCGAGCAGAAGCTATCATTAGCTCTAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACACCTGATACAATGGAAAATTATGA
ATATATCACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAATCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACAGATTTACAAAACGAACAGACGGTAA
GCGAAATTTTGAGAAAGATCAGAGAAGTGGAATCAAAAAATAAGGCATTAAATAAATAA
 Primer design