SecReT4
Protein ID: 15645158
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0532
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]565073..565915 [+]
Productcag pathogenicity island protein (cag12)
Component typeCagT
UniProt IDP97245
KEGG IDhpy:HP0532
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|15645158|ref|NP_207328.1| cag pathogenicity island protein (cag12) [Helicobacter pylori 26695]
MKLRASVLIGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNSKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAKEEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|15644634|ref|NC_000915.1|:565073-565915 Helicobacter pylori 26695 chromosome, complete genome
ATGAAACTGAGAGCAAGTGTTTTAATCGGTGCGACAATTCTGTGCTTAATTTTAAGCGCATGCAGTAATT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAGAAGTA
TAGTGAGATACCCTTAAATGACAAACTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGACTATTTGTTGGATAATAAACAAGTTGTACTAACTTTCAAACTTGTTCACCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATACTTCAATACAAGAATTACTTCCAAGCTAATGGAGCGAGATCTGA
CATTGATTTTTACTTGCAACCCACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTACAATGAT
AATCCTAACAGCAAAGAAAAACCACAGACCTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAAACTCTTTTACAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACATTGAGTAATCGTGCAGGTTATCAAATGAGGC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAAAGAGGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTGCGAAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design