SecReT4
Protein ID: 15645163
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0537
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]568723..569853 [+]
Productcag pathogenicity island protein (cag16)
Component typeCagM
UniProt IDO25270
KEGG IDhpy:HP0537
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|15645163|ref|NP_207333.1| cag pathogenicity island protein (cag16) [Helicobacter pylori 26695]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLIFRKQKIKE
LMDHRAKVLSDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNPLYRKLLPNPYAYVLNQETFT
KEDRERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNVSN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVVSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|15644634|ref|NC_000915.1|:568723-569853 Helicobacter pylori 26695 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCATTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAAGTGGCTGCAAAAGAAGACGCTCTTAAGGCTCG
CAAGAAGCTCTTAAACAATACGCATGATTTCTTAGAAGACTTGATTTTTAGAAAACAAAAAATCAAAGAG
CTTATGGATCATAGAGCTAAAGTTCTTTCAGACTTAGAAAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGGGATTTGGAGCAAGCCTTAAA
AGATAACCCTCTCTATAGGAAACTTCTTCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACC
AAAGAAGATAGGGAGCGTTTGAGTTATTACTACCCCCAGGTGAAAACGAGCAGTATTTTTAAAAAAACCA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTTTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACGTTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTACAGCTTGAAAGAAACAAGTTTGACTCCA
AAGCAAAAGATATTGCTCAAAAGGCTACTAACACGCTTATTTTTAATTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATCAATGAGAAATACTTAAGGGGCTATGAGGCTTTTTCTAACTTGTTGAAAAATGTC
AAAGATGATGTGGAATTGAATACTCTGACTAAAAATTTTACCAATCAAAAATTGAGTTTCGCACAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATTTTCGTAGATAGCGATCCTATGATGAGCGACAAAACCACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGGTTTCTGCATACCGAAACAATGTTGCCAAGAATAATC
CCTTTGAATAG
 Primer design