SecReT4
Protein ID: 15645164
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0538
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]569868..570788 [+]
Productcag pathogenicity island protein (cag17)
Component typeCagN
UniProt IDO25271
KEGG IDhpy:HP0538
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|15645164|ref|NP_207334.1| cag pathogenicity island protein (cag17) [Helicobacter pylori 26695]
MKSIFKKLGSVALYSLVIYGGLNAINTALLPSEYKELVALGFKKIKTLHQRHDDEEVTKEEKEFATNALR
EKLRNDRARAEQIQKNIEAFEKKNNSSIQKKAAKHKGLQELNEINATPLNDNPNSNSSTETKSNKDDNFD
EMINKVNGAFVKPATPLVPDEWRTPEIEIIINECIISSNDYDGLRKCLIKGIKDQKILAPLLEKIQEIET
ENNKFSRQHLSGLKLALNNSNNRTFLIASCAICEKRKKEMEQENNYQDTTNASEFGATDTKENEAKDAAF
SNNRSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|15644634|ref|NC_000915.1|:569868-570788 Helicobacter pylori 26695 chromosome, complete genome
TTGAAAAGTATCTTCAAAAAACTAGGTTCTGTCGCTCTTTATTCTTTAGTTATTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTGCCGAGTGAATACAAAGAATTAGTGGCTTTGGGCTTTAAAAAAATCAAAAC
ACTCCATCAAAGACATGACGACGAAGAAGTTACAAAAGAGGAAAAAGAATTCGCCACTAACGCTTTGAGA
GAAAAATTACGAAATGATAGGGCAAGAGCAGAGCAAATTCAAAAGAATATTGAAGCGTTTGAAAAAAAGA
ACAACTCTTCTATTCAAAAAAAAGCGGCTAAGCACAAAGGATTACAAGAATTAAACGAAATTAACGCTAC
CCCTTTGAATGACAACCCTAATAGCAATTCTTCCACTGAAACCAAATCTAATAAAGATGATAACTTTGAT
GAGATGATCAATAAGGTGAATGGAGCTTTTGTGAAACCTGCTACTCCGCTTGTGCCTGATGAGTGGAGAA
CGCCTGAAATTGAAATCATTATCAATGAGTGTATTATTTCAAGCAACGATTATGATGGGTTAAGAAAGTG
TTTGATCAAAGGCATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATTCAAGAAATAGAGACA
GAAAATAACAAATTTTCTAGACAACACTTGAGTGGTTTAAAACTCGCTCTTAATAACAGCAACAATAGAA
CCTTTCTTATAGCTTCGTGCGCTATTTGTGAGAAGAGAAAAAAAGAAATGGAGCAAGAAAATAACTACCA
AGATACTACAAATGCAAGTGAGTTTGGAGCTACTGATACAAAAGAAAATGAAGCAAAAGATGCAGCATTC
TCAAACAATCGCTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCGCTCATG
GGAAAAAATAG
 Primer design