SecReT4
Protein ID: 15645165
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0539
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]570870..571583 [-]
Productcag pathogenicity island protein (cag18)
Component typeCagL
UniProt IDO25272
KEGG IDhpy:HP0539
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|15645165|ref|NP_207335.1| cag pathogenicity island protein (cag18) [Helicobacter pylori 26695]
MKTLVKNTISSFLLLSVLMAEDITSGLKQLDSTYQETNQQVLKNLDEIFSTTSPSANNEMGEEDALNIKK
AAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQNTAEQQCGISDKVLVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEE
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|15644634|ref|NC_000915.1|:c571583-570870 Helicobacter pylori 26695 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCATATCTTCTTTTTTGCTCTTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGTTTAAAGCAACTGGATAGCACCTACCAAGAGACCAACCAACAAGTGCTCAAAAACTTAGATGA
GATTTTTTCAACCACTAGCCCTAGTGCTAATAATGAAATGGGTGAAGAAGATGCTCTAAACATCAAAAAA
GCGGCCATTGCTTTGAGAGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTCAAAACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAATACTGCTGAGCAACAATGCGGAATATCCGATAAAGTTTTAGTTCTTTATTGTGAA
GGGAAGCTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCTCTAAAGGCATATC
AGAGCAACATTGGAGGTACAGCTTCCTTAATCACTGCTTCACAGACGCTTGTAGAAAGCCTAAAAAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCACAACAAGGTCTTTTTAAATTATTTAGAGGAG
TTGGACGCATTAGAAAGATCCCTAGAACAAAGTAAGCGACAATACCTACAAGAAAGGCAATCAAGTAAGA
TCATTGTTAAATGA
 Primer design