SecReT4
Protein ID: 15645168
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0542
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]573864..574292 [-]
Productcag pathogenicity island protein (cag21)
Component typeCagG
UniProt IDO25275
KEGG IDhpy:HP0542
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|15645168|ref|NP_207338.1| cag pathogenicity island protein (cag21) [Helicobacter pylori 26695]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAVL
NDYNDKNVNIKFDNISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYSDSSFLPPIL
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|15644634|ref|NC_000915.1|:c574292-573864 Helicobacter pylori 26695 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CGCTTAATGCTGACCAAAACACGGATATAAAAGATATTAGTCCTGAAGATATGGCACTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAACTAAAAATAGAGATCCCTAAAGAAACCCTAGAACAAAAAGTGGCCGTACTC
AATGACTATAATGATAAGAATGTTAATATCAAGTTTGACAACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGTATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
TCCAAACAATCCTTTCATGTATGGTTATGCACCAACATACTCAGATTCATCATTTTTACCACCGATCTTA
GGGTATTAA
 Primer design