SecReT4
Protein ID: 15645171
T4SS name [ID]Cag [4]
Gene symbol-
Locus tagHP0545
StrainHelicobacter pylori 26695
Repliconchromosome [GenBank: NC_000915] [Browse all T4SS(s) in this replicon]
Location [Strand]578115..578738 [-]
Productcag pathogenicity island protein (cag24)
Component typeCagD
UniProt IDO25277
KEGG IDhpy:HP0545
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 207 a.a.     [Download]
>gi|15645171|ref|NP_207341.1| cag pathogenicity island protein (cag24) [Helicobacter pylori 26695]
MINNNSNKKLRGFFVKVLLSLVVFSSYGLANDDKEAKKEVLEKEKNTPNGLVYTNLDFDSFKATIKNLKD
KKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPVIEKIFDEKGKEMGLNVELQINPEVKDFFTFK
SISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTVESLKKIFYTITCEAVYL
 
Nucleotide Sequence: 624 bp     [Download]
>gi|15644634|ref|NC_000915.1|:c578738-578115 Helicobacter pylori 26695 chromosome, complete genome
TTGATCAATAATAATAGTAATAAAAAACTGAGAGGCTTTTTTGTGAAAGTTCTCTTAAGTCTCGTTGTTT
TCAGTTCGTATGGGTTAGCAAATGACGATAAAGAAGCCAAAAAAGAAGTGCTAGAAAAAGAAAAAAACAC
TCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTCAAGGCGACTATCAAAAATTTGAAAGAC
AAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAGATGAAGTTTTTGACTTCGTGATTGTCA
ATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCCAGTTATTGAAAAAATCTTTGATGAAAA
GGGTAAAGAAATGGGATTGAATGTGGAATTGCAGATCAATCCTGAAGTGAAAGACTTTTTTACTTTTAAA
AGCATCAGCACGACCAACAAACAACGCTGCTTTCTATCGTTGCGCGGGGAAACAAGAGAAATTTTATGCG
ATGATAAGCTGTATAATGTTTTATTGGCCGTATTCAATTCTTATGACCCTAATGATCTTTTGAAACATAT
TAGCACCGTAGAGTCTCTCAAAAAAATCTTTTATACGATTACATGTGAAGCGGTATATCTATAA
 Primer design