SecReT4
Protein ID: 156936509
T4SS name [ID]VirB [408]
Gene symbol-
Locus tagESA_pESA2p06555
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA2 [GenBank: NC_009779] [Browse all T4SS(s) in this replicon]
Location [Strand]752..2488 [+]
Producthypothetical protein
Component typeVirD4
UniProt IDA7MRC1
KEGG IDesa:ESA_pESA2p06555
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-10, Aligned region: 338..535
TrwB_AAD_bind [PF10412], Evalue: 2.6e-10, Aligned region: 378..536
TraG-D_C [PF12696], Evalue: 1.4e-07, Aligned region: 399..498
AAA_10 [PF12846], Evalue: 6.2e-07, Aligned region: 375..477
Protein Sequence: 578 a.a.     [Download]
>gi|156936509|ref|YP_001440424.1| hypothetical protein ESA_pESA2p06555 [Cronobacter sakazakii ATCC BAA-894]
MGSHLVQRLNGFADAFSVFLLWLQNSPVILSILAGLTLPFIFHLPREERKNAPFWLKSVACASIFFFIFG
TISPLTIQGLSYLFKVLDNNIIFKPVLWGLTIAFTFIGLFFHIMTRRLLAGEIDHLKHRMIKKSKLERNT
RTDVREVKEMLPDSITYNPLDYIDISKGVFIGLDKDDHPQYITVEEFQSQHADMIGTTGSGKGVSASVLL
YQAILLDEGVFVEDPKNDEWAPHVLREACRVAGKEFTLINLNDLNFQLDLLADINHEQLEELFNAGFSLA
KKGEGADFYRIADRRAARKTSAIYEKGMTLRDLFNTDFVKSLEEDVPAFYGELEEIALVNSINATYGFSL
KKIFDEGGCCYIIGSMRNQKIISAQRMILTRLIQIAETRDRIKEKPRPIAIFLDELKYHLSRPALEGLGA
ARDKGVHILMAHQSIKDLYDCPADLDGDAVAGSVVENCKFMLVYRLRDPDTAEWVARMTGSILVDDEMRK
VTTDISLTEKMDTDRMIRQAERYYIDSNMLLNLPKFVGFVFTQNDLAKATKLYHIPAKKKYIELLSFEDK
SASPAFNESEQERPSIDL
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|156936507|ref|NC_009779.1|:752-2488 Cronobacter sakazakii ATCC BAA-894 plasmid pESA2, complete sequence
ATGGGATCACATCTGGTGCAAAGGCTTAATGGCTTTGCAGACGCCTTTTCTGTTTTTCTCTTATGGCTGC
AAAACAGCCCGGTAATACTCTCAATATTGGCAGGGCTTACGCTTCCTTTTATATTCCACCTACCGAGGGA
GGAAAGAAAAAACGCACCATTCTGGTTAAAGAGTGTAGCGTGTGCGTCTATCTTCTTCTTTATTTTCGGA
ACAATATCACCGCTTACCATACAGGGCTTAAGCTACCTGTTTAAAGTTCTCGATAACAATATTATCTTCA
AGCCGGTACTCTGGGGGCTGACGATTGCATTCACCTTTATCGGTTTATTTTTCCACATAATGACACGCAG
ATTACTGGCAGGGGAAATCGACCACCTTAAACACCGGATGATTAAAAAGAGCAAACTGGAAAGAAATACA
AGAACAGACGTAAGGGAAGTAAAGGAAATGCTGCCTGACAGCATCACATACAATCCACTTGATTATATCG
ACATTTCAAAAGGCGTATTCATTGGCTTAGATAAAGATGACCACCCGCAATATATAACGGTTGAAGAGTT
TCAGTCTCAGCACGCAGATATGATAGGTACAACCGGTTCCGGTAAAGGTGTAAGCGCCTCTGTTCTTCTT
TATCAGGCAATCTTATTAGACGAAGGCGTCTTTGTTGAAGACCCGAAAAACGATGAATGGGCTCCGCACG
TTCTCCGTGAAGCCTGCCGAGTTGCCGGGAAAGAGTTCACACTGATAAACCTTAATGACCTTAATTTCCA
GCTAGACCTTTTAGCTGATATTAATCATGAGCAACTGGAAGAACTTTTTAACGCAGGCTTTAGCCTGGCT
AAAAAAGGAGAGGGTGCAGACTTTTATCGAATCGCTGACCGCAGGGCAGCAAGAAAAACATCCGCGATTT
ATGAAAAAGGAATGACACTCCGCGATTTATTTAACACAGACTTTGTTAAATCTTTGGAGGAAGATGTCCC
GGCATTCTATGGTGAATTAGAAGAGATAGCGCTGGTTAACTCAATAAATGCCACATACGGCTTCTCTCTT
AAAAAGATATTTGACGAGGGCGGCTGCTGTTACATTATTGGTTCAATGCGCAACCAGAAAATTATTTCTG
CTCAACGTATGATACTCACACGACTCATTCAAATCGCCGAGACGCGAGACAGGATAAAAGAGAAGCCCCG
GCCAATTGCCATTTTCCTTGATGAACTTAAATATCATCTCTCACGTCCTGCTCTGGAAGGTTTAGGCGCA
GCCAGGGATAAAGGCGTGCATATATTAATGGCTCACCAGTCAATTAAAGACCTTTACGATTGCCCCGCAG
ATTTAGATGGTGATGCCGTTGCCGGTTCTGTGGTTGAAAACTGCAAATTCATGCTGGTTTATCGTCTGCG
CGATCCTGATACAGCAGAGTGGGTAGCAAGAATGACGGGCTCTATTCTTGTTGATGATGAAATGAGAAAG
GTCACAACTGATATATCTCTTACTGAGAAAATGGATACTGACAGGATGATAAGGCAGGCTGAAAGATACT
ATATCGATTCAAATATGCTGCTTAACCTTCCTAAATTCGTTGGCTTCGTTTTCACACAAAATGACCTGGC
AAAAGCCACCAAGCTTTACCATATACCAGCCAAGAAAAAGTATATCGAGCTTCTTTCCTTTGAGGATAAA
TCCGCATCGCCTGCCTTTAATGAAAGTGAGCAGGAAAGACCATCTATCGACTTGTGA
 Primer design