SecReT4
Protein ID: 156936539
T4SS name [ID]VirB [408]
Gene symbol-
Locus tagESA_pESA2p06585
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA2 [GenBank: NC_009779] [Browse all T4SS(s) in this replicon]
Location [Strand]25923..26606 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDA7MR99
KEGG IDesa:ESA_pESA2p06585
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.6e-53, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|156936539|ref|YP_001440454.1| hypothetical protein ESA_pESA2p06585 [Cronobacter sakazakii ATCC BAA-894]
MSEQKLIAESRSFEQREIERDKRAAKAGFVVGGAGLLIAVLAVAAILVMLPLKETTVELVTVDNHTGRTQ
HITRASKTSITAEEAYQKAMAANYVKIRERYVYPSLQDDYETVQMYNSPEVNNDYLALYAGKNAPDKVYN
NGANTVKIDILSSQITDGTAPDKVATIRYKKTIRRLVDNQTRYEYWDARFTFHSDPNKEMSDEEREVNYF
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|156936507|ref|NC_009779.1|:25923-26606 Cronobacter sakazakii ATCC BAA-894 plasmid pESA2, complete sequence
ATGAGTGAACAGAAATTAATTGCTGAGTCCCGCAGCTTTGAACAACGGGAAATCGAACGCGATAAACGCG
CAGCGAAAGCCGGTTTCGTGGTGGGCGGTGCGGGGCTGCTGATCGCAGTTCTGGCCGTCGCTGCAATTCT
GGTGATGTTGCCCCTTAAAGAGACAACAGTGGAGCTGGTTACCGTGGACAATCATACCGGTCGAACGCAG
CACATAACCCGTGCATCAAAAACCAGTATCACGGCTGAGGAAGCCTATCAGAAAGCGATGGCGGCTAATT
ACGTAAAAATTCGCGAGCGCTACGTCTATCCCTCCCTCCAGGACGATTACGAGACGGTTCAGATGTACAA
CAGCCCTGAGGTCAACAATGACTATCTGGCGTTGTATGCCGGTAAAAACGCCCCGGATAAGGTTTACAAC
AACGGGGCTAACACGGTGAAGATTGACATCCTGTCCAGTCAGATCACCGATGGCACGGCTCCCGATAAGG
TCGCCACTATCCGGTACAAAAAGACCATCCGCCGCCTTGTTGATAACCAGACCCGTTACGAGTACTGGGA
TGCGCGTTTTACGTTCCACTCTGACCCGAATAAAGAGATGAGCGACGAAGAGCGCGAGGTTAACTATTTC
GGTTTTACCGTCACGAGCTGGCAGACAGACCGTGAAATCCGGGGAGGTGAATGA
 Primer design