SecReT4
Protein ID: 156936542
T4SS name [ID]VirB [408]
Gene symbol-
Locus tagESA_pESA2p06588
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA2 [GenBank: NC_009779] [Browse all T4SS(s) in this replicon]
Location [Strand]28855..29880 [+]
Producthypothetical protein
Component typeVirB11
UniProt IDA7MRA4
KEGG IDesa:ESA_pESA2p06588
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-47, Aligned region: 17..279
Protein Sequence: 341 a.a.     [Download]
>gi|156936542|ref|YP_001440457.1| hypothetical protein ESA_pESA2p06588 [Cronobacter sakazakii ATCC BAA-894]
MTATNISLDRYKQRFFGEFLELPGLTEIAVNRPDELFTKIDGVWTQHAVSLSYDDCYNFARCLAKHHNDN
IEDIKPGLSATLESGERCQLVVPPACERGTVSATIRKPSRVQIPHQSYIDAGFYNRVTGSEQTETHDAEL
IALYNTKNIPLFMEKCVEYGKTIAVAGETSTGKTTYMKMLIGYIPLDLRITTIEDNPEITFFKHKNYVHL
FYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAMEAIDG
FITRCYENPQCAQLPYAFMLRKVLDSLDVIVSIDLDGNIRRMNDIYFRPVHRKEYFEAMKS
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|156936507|ref|NC_009779.1|:28855-29880 Cronobacter sakazakii ATCC BAA-894 plasmid pESA2, complete sequence
ATGACGGCTACTAACATCTCTCTAGACCGCTATAAGCAACGGTTTTTTGGTGAATTCCTTGAGCTTCCCG
GACTCACAGAAATTGCTGTAAACCGTCCTGATGAGCTGTTTACGAAAATTGATGGCGTGTGGACACAGCA
CGCCGTTTCTCTCAGCTATGACGACTGCTATAACTTTGCCCGCTGCCTGGCAAAGCATCACAACGACAAC
ATAGAGGACATTAAGCCGGGGCTGTCGGCCACGCTGGAATCTGGCGAACGCTGCCAGTTGGTTGTACCTC
CGGCATGTGAGCGCGGCACGGTCTCTGCCACAATCCGAAAACCTTCGAGGGTACAAATCCCGCACCAGTC
ATACATTGATGCGGGATTTTATAATCGTGTTACGGGCTCTGAACAAACCGAAACGCACGATGCCGAACTA
ATTGCATTGTACAATACAAAAAACATTCCGCTCTTTATGGAAAAGTGCGTTGAATACGGGAAAACCATTG
CTGTTGCAGGTGAAACGAGCACGGGGAAAACAACCTATATGAAAATGCTGATAGGTTATATCCCGCTTGA
CCTCAGGATCACAACTATTGAGGACAACCCCGAAATTACGTTCTTTAAACATAAAAACTATGTGCATCTT
TTTTATCCGTCTGAGTCATCAGACGAAAAAGGTTCAATTGTTACGCCAGCGAGTCTTTTGCGCTGGAATT
ACCGTATGAACCCTGACCGCATTTTATTAACAGAGGTCAGGGGAGCCGAAGCCTGGGACTTCCTGAAAAT
AACAGGTTCAGGTCATGAAGGGAGTATGACGTCTATTCATGCTGGTTCGGCAATGGAAGCCATCGATGGT
TTTATTACACGCTGCTATGAAAACCCACAATGCGCACAACTTCCCTATGCCTTTATGTTACGTAAGGTGC
TGGATAGCCTGGACGTTATTGTGAGTATCGATCTGGACGGCAATATCCGCAGAATGAATGATATTTATTT
CCGTCCTGTACATCGAAAAGAATATTTCGAGGCCATGAAATCATGA
 Primer design