SecReT4
Protein ID: 156936719
T4SS name [ID]VirB [778]
Gene symbol-
Locus tagVIBHAR_p08203
StrainVibrio harveyi ATCC BAA-1116
Repliconplasmid pVIBHAR [GenBank: NC_009777] [Browse all T4SS(s) in this replicon]
Location [Strand]32440..34218 [-]
Productconjugal transfer protein TraK
Component typeVirD4
UniProt IDA7N906
KEGG IDvha:VIBHAR_p08203
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-92, Aligned region: 129..576
TraG-D_C [PF12696], Evalue: 6.8e-31, Aligned region: 416..534
TrwB_AAD_bind [PF10412], Evalue: 5.2e-20, Aligned region: 222..535
Protein Sequence: 592 a.a.     [Download]
>gi|156936719|ref|YP_001436070.1| conjugal transfer protein TraK [Vibrio harveyi ATCC BAA-1116]
MALSKKKKGILFAMFLFFTLLCLIGGLYGGGAAYYKLTNISLEHLTYHSLFDQWQAYSHNPDIKKFLVIG
VAVSIAITLFPTLMAIVIAIASQEREEIHGSAKFATDMDLANSGLFPNPKAKNKKPSILLGKMPKGRFKG
RFIELESSQFVEVPAPTRSGKGVGIVIPNCVTYPDSLVCVDIKFENLVKSGGFRQQCGQAVFLFAPDGYA
IDEQAREREELRTHQWNPYDYVRRSPVFRVSDVLNIANSLYPISGDKGDIWNELAGKLFKGLSCWMLDTE
SITGITPSLPYVLKLGGIDGGLRAWMRREIKNDYVSDDARFEFNNCLSMAEETYSSVESNLLSPLAIFSD
RVTAAAVSGSDFDFRELRKKRMTIYVGCQPANLKNFGKLFNLFFEQLISENTRTLPEHDDTLKYQCLGLL
DEFTALGRVKQIEKAISYTAGYNLRFLTIYQDEGQLEEVYGRENAKNIRKNHGVKVVYPPKEVDDNVRRL
SDTLGTKTVKKRKVSRSTGKGSSRTTSEDELKRPLMMPHEIVELGFEKHPIAKELGIKTLILKENQRPFI
AEKIIYFEEPVFAERVKYSEANIPEIPRLKLH
 
Nucleotide Sequence: 1779 bp     [Download]
>gi|156936674|ref|NC_009777.1|:c34218-32440 Vibrio harveyi ATCC BAA-1116 plasmid pVIBHAR, complete sequence
ATGGCGCTATCGAAAAAGAAAAAAGGAATATTGTTCGCCATGTTCCTTTTTTTTACCCTGCTGTGTTTAA
TTGGTGGCTTGTACGGTGGCGGCGCTGCCTATTACAAGCTCACCAACATCTCGTTAGAGCACCTGACGTA
TCACAGCCTCTTTGACCAGTGGCAAGCCTACAGCCACAACCCCGACATCAAGAAGTTCTTGGTGATTGGG
GTGGCCGTGAGTATCGCCATCACTTTGTTTCCGACGCTGATGGCCATCGTGATAGCCATTGCCAGCCAAG
AAAGAGAAGAAATCCACGGCAGTGCGAAGTTCGCGACCGACATGGACTTGGCGAACTCTGGTCTTTTCCC
TAACCCGAAAGCCAAGAACAAGAAGCCAAGCATCTTGTTAGGCAAGATGCCCAAAGGCCGCTTTAAAGGC
CGTTTTATCGAGCTAGAGAGCTCGCAGTTTGTTGAAGTCCCTGCCCCAACCCGAAGCGGTAAAGGGGTCG
GCATAGTTATCCCTAACTGCGTGACCTATCCCGATTCGTTGGTTTGTGTCGATATTAAATTCGAGAACTT
GGTTAAAAGCGGCGGATTTCGTCAGCAATGCGGTCAAGCCGTTTTCTTGTTTGCGCCGGATGGGTATGCC
ATCGATGAGCAAGCGCGAGAGCGCGAAGAGCTTCGCACACATCAATGGAATCCTTACGACTACGTTCGCA
GAAGTCCCGTGTTTCGAGTGAGCGATGTGCTCAATATTGCTAACAGCTTATACCCCATTTCTGGGGATAA
GGGCGATATTTGGAATGAGTTAGCGGGTAAGTTATTTAAAGGGCTCAGTTGTTGGATGCTCGATACCGAG
TCCATTACAGGTATCACGCCCTCTTTGCCCTACGTGCTGAAACTGGGTGGCATCGATGGCGGCCTAAGAG
CATGGATGCGCCGAGAAATCAAAAACGACTACGTCTCTGACGATGCGCGTTTTGAGTTCAATAACTGCTT
GTCGATGGCCGAAGAGACGTATTCGAGCGTCGAAAGTAACTTACTCAGCCCATTGGCGATATTCAGTGAC
CGCGTCACCGCAGCCGCCGTCAGTGGTTCGGATTTTGATTTTCGTGAGCTGCGCAAAAAGCGCATGACCA
TCTACGTCGGTTGTCAGCCAGCTAACCTCAAAAACTTTGGCAAGCTGTTCAACTTGTTTTTCGAGCAGCT
TATTTCAGAAAACACCCGCACCCTACCCGAACATGACGACACCCTGAAATATCAGTGTTTGGGTTTGCTC
GATGAGTTCACCGCCCTTGGCCGAGTAAAGCAAATCGAAAAAGCAATCAGCTACACCGCTGGTTACAACC
TGCGATTTTTAACCATCTACCAAGACGAAGGCCAACTCGAAGAAGTGTATGGCCGAGAGAACGCAAAAAA
CATTCGCAAGAACCACGGCGTTAAGGTGGTGTACCCACCGAAAGAAGTGGACGACAACGTTCGCCGCCTT
TCTGACACCTTGGGTACCAAAACGGTGAAAAAACGCAAAGTCAGTCGCAGTACGGGCAAAGGTTCAAGCC
GAACAACCAGTGAAGATGAGCTGAAACGCCCGCTGATGATGCCGCATGAAATCGTTGAGCTTGGCTTTGA
GAAACACCCGATAGCCAAAGAGCTCGGTATCAAAACCTTGATATTGAAAGAGAACCAACGCCCGTTCATT
GCAGAGAAAATCATCTACTTTGAAGAGCCCGTGTTCGCTGAGCGAGTGAAATACTCCGAGGCGAATATCC
CTGAAATCCCACGCCTTAAACTCCATTGA
 Primer design