SecReT4
Protein ID: 156936720
T4SS name [ID]VirB [778]
Gene symbol-
Locus tagVIBHAR_p08204
StrainVibrio harveyi ATCC BAA-1116
Repliconplasmid pVIBHAR [GenBank: NC_009777] [Browse all T4SS(s) in this replicon]
Location [Strand]34222..35238 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDA7N8V2
KEGG IDvha:VIBHAR_p08204
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.2e-60, Aligned region: 20..314
Protein Sequence: 338 a.a.     [Download]
>gi|156936720|ref|YP_001436071.1| type II secretion system protein E [Vibrio harveyi ATCC BAA-1116]
MNTIDKAATVNQLLSMTGLRHYLDLEGLTEIAINRPNEVWFDRGNGWERDALPNLSLNMCSNLAKALATF
AGLTIPLGEANPVASVIFPDGERGQIAIPPATENGIVSMTIRKPSLTRFALSSYQESGRFSDFREMDVNR
VELTPVQEQLLTLKQNGDMSQFFSMAVKSKLNILLVGGTGSGKTTVMKAMVDEYPTDKRLFTIEDVHELD
LPNHPNHLHLFYKQGGLTPKQIIESCMRMKPDHVLLAELRGDEAWTYLEMLNTGHEGSITTIHANDCYST
PARLAGLVKQSEVGQTLDYHHIMRTIRTSIDVIAFFKHTHLVELFYDPVEKNRLLSEG
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|156936674|ref|NC_009777.1|:c35238-34222 Vibrio harveyi ATCC BAA-1116 plasmid pVIBHAR, complete sequence
ATGAACACCATCGATAAAGCCGCAACGGTCAATCAATTACTCAGCATGACCGGACTGCGGCACTACTTAG
ACTTAGAAGGGCTCACCGAGATAGCCATCAATCGACCTAACGAGGTGTGGTTTGACCGTGGTAACGGTTG
GGAGCGCGACGCGCTGCCAAACTTATCATTAAACATGTGCAGCAATCTCGCGAAAGCGTTAGCCACTTTC
GCGGGACTGACCATTCCTCTCGGTGAAGCCAACCCGGTCGCCTCAGTCATTTTTCCTGATGGCGAGCGCG
GTCAAATTGCTATCCCCCCCGCCACAGAAAACGGCATTGTCAGCATGACCATCCGAAAGCCTTCCCTCAC
TCGATTTGCGCTGTCGAGCTACCAAGAAAGCGGTCGCTTCTCTGATTTTAGAGAAATGGATGTGAACCGT
GTTGAATTAACACCGGTTCAAGAGCAGCTTCTCACGCTCAAACAAAATGGCGATATGTCGCAATTCTTTA
GCATGGCAGTAAAGAGCAAGCTCAACATCTTGCTCGTTGGTGGTACTGGTTCAGGTAAAACCACCGTCAT
GAAAGCGATGGTGGACGAATACCCCACCGATAAGCGCCTCTTCACCATTGAAGATGTGCATGAGCTCGAC
TTACCCAATCATCCCAATCACCTTCATCTGTTTTACAAGCAAGGCGGCTTAACCCCGAAACAAATCATCG
AGTCGTGTATGCGAATGAAACCCGACCACGTGTTGTTGGCCGAGCTGCGTGGGGATGAGGCATGGACGTA
CCTTGAAATGCTCAACACCGGACACGAAGGCTCAATCACCACCATTCACGCCAACGACTGTTATTCCACA
CCCGCACGACTGGCGGGATTAGTGAAACAATCCGAAGTCGGCCAAACACTCGATTATCACCACATCATGC
GAACCATTCGAACCAGCATCGATGTGATTGCCTTTTTCAAACACACTCACCTCGTCGAACTCTTTTACGA
CCCCGTCGAGAAGAATCGACTGTTAAGCGAGGGCTAA
 Primer design