SecReT4
Protein ID: 156936724
T4SS name [ID]VirB [778]
Gene symbol-
Locus tagVIBHAR_p08208
StrainVibrio harveyi ATCC BAA-1116
Repliconplasmid pVIBHAR [GenBank: NC_009777] [Browse all T4SS(s) in this replicon]
Location [Strand]37539..38294 [-]
Productconjugal transfer protein TraG
Component typeVirB8
UniProt IDA7N8V5
KEGG IDvha:VIBHAR_p08208
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-56, Aligned region: 35..247
Protein Sequence: 251 a.a.     [Download]
>gi|156936724|ref|YP_001436075.1| conjugal transfer protein TraG [Vibrio harveyi ATCC BAA-1116]
MSTTIDSALEHNHTKAEKKPTAKHQKQADAYLEEIKQFEQDRIEIAKKNAKTAWKVATGSCVLALVLGIT
IVVMMPLKTVDYRLLYIDPQTGMTQIIQPLADAREITYGEALDKHWLNRYVITRGSYQWQTVQDAFDYVK
LTSRHDVFSAYSTQLRAKNSPVEVFKDYKKIRLEDVAISFLPTRQDQMLAQVSFTKVVLNSDDTPDTAYL
PTKWSATVTFDYLKEIKTESERQLNPLGFRVTSYQENRVIQ
 
Nucleotide Sequence: 756 bp     [Download]
>gi|156936674|ref|NC_009777.1|:c38294-37539 Vibrio harveyi ATCC BAA-1116 plasmid pVIBHAR, complete sequence
ATGAGCACAACCATCGATTCTGCCTTGGAACACAATCATACCAAGGCCGAGAAAAAACCAACCGCCAAAC
ATCAAAAGCAAGCTGATGCGTACCTCGAAGAGATTAAGCAGTTCGAGCAAGACCGCATCGAAATCGCCAA
GAAAAATGCGAAGACCGCATGGAAAGTCGCAACGGGTTCCTGCGTTCTCGCTTTGGTGCTCGGCATTACG
ATTGTTGTGATGATGCCACTAAAAACCGTGGACTATCGATTGCTCTACATCGATCCACAAACAGGCATGA
CTCAAATTATTCAACCACTCGCTGACGCAAGAGAAATCACCTACGGCGAAGCGTTAGATAAGCATTGGTT
GAATCGTTACGTCATTACTCGCGGCTCTTATCAATGGCAAACCGTTCAAGACGCTTTTGACTACGTCAAA
CTCACCAGTCGTCACGACGTATTCAGCGCTTACAGCACGCAGCTACGAGCCAAGAACTCCCCTGTCGAAG
TGTTCAAAGACTATAAGAAAATCCGCTTAGAAGACGTTGCCATTTCGTTCTTGCCAACCCGACAAGACCA
AATGCTCGCGCAAGTGTCCTTCACTAAAGTGGTGCTCAATAGCGATGACACGCCAGACACCGCTTACCTA
CCGACCAAATGGAGCGCCACCGTTACCTTTGATTACCTCAAGGAAATCAAAACGGAATCAGAGCGCCAAC
TTAACCCACTTGGTTTCCGAGTCACCAGTTATCAAGAAAACAGGGTGATCCAATGA
 Primer design