SecReT4
Protein ID: 156978730
T4SS name [ID]Tra_Tn [657]
Gene symbol-
Locus tagSAHV_0399
StrainStaphylococcus aureus subsp. aureus Mu3
Repliconchromosome [GenBank: NC_009782] [Browse all T4SS(s) in this replicon]
Location [Strand]446153..448606 [-]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDA7WYA8
KEGG IDsaw:SAHV_0399
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.6e-34, Aligned region: 468..763
Protein Sequence: 817 a.a.     [Download]
>gi|156978730|ref|YP_001440989.1| hypothetical protein SAHV_0399 [Staphylococcus aureus subsp. aureus Mu3]
MAYPIKYMEDNLVFNHDGEVFAYYELIPYNYSFLSSDEKIQVHDNFCQLIAQNRDGKIHALQLATESSIR
ATQEQSKKEITGRLKEIAYEKIDEQTEALISMIGDNQVDYRFFIGFKLYLNEQEVSVKNVGKEIQKAFAE
FFHGVNHKLMGDFVSMPMAEIERFSKMEQLLESKLSRRFQIRKLEKDDFGYIIEHLYGQTGVPFDDYDYH
LPKRYEDKKVLVKKYDILKPTRCLIEENQRYLRIEQEDTTTYVAYFTINSIVGELDFPNSEIFYYQQQQF
TFPVDTSMNVEIVANKKALSTVRNKKKELKDLDSHAWESDNETSTNVVDALESVDELESNLDQTKESMYK
LSYVVRVSAKNLDELKQRCDEVKDFYDDLSIKLVRPFGDMLGLHNEFIPSSKRYINDYIQYVTSDFLAGL
GFGATQMIGENSGIYVGYNLDTGRNIYLQPSLASQGIKGSVTNALASAFIGSLGGGKSFSNNMLVYYSVL
FGGQATIVDPKAERGEWKETLPDIAHEINIVNLTSENDNKGLLDPYVILKLPKDSESLAIDILTFLTGIS
SRDSEKFPVLRKAIRSVTQSKQRGLLLVIDELRKEDTPISNSIADHIESFVDYDFAHLLFSDGSVTQSIS
LEKQLNIIQVADLVLPDSNSSFEEYTTMELLSVAMLIVISTFALDFIHSDRSIFKIVDLDEAWSFLQVAQ
GKALSMRLVRAGRAMNAGVYFVTQNADDLLDEKMKNNIGLKFAFRSTDLVEIKKTLEFFGVDKEDENNQK
RLRELENGQCLVSDIYGRVGVMQFHPIFEELLHAFDTRPPVRNEVEE
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|156978331|ref|NC_009782.1|:c448606-446153 Staphylococcus aureus subsp. aureus Mu3, complete genome
ATGGCATATCCGATTAAATATATGGAAGATAATCTCGTATTTAATCATGATGGCGAAGTATTCGCTTATT
ATGAATTAATTCCCTATAATTACAGTTTTTTAAGTTCCGATGAAAAAATTCAAGTTCATGATAATTTCTG
TCAATTGATTGCCCAAAATCGTGATGGCAAGATTCATGCTCTGCAACTAGCAACCGAATCAAGTATTCGA
GCCACACAGGAACAATCGAAAAAAGAAATCACTGGACGATTAAAAGAGATAGCTTACGAAAAAATAGATG
AACAGACCGAAGCGTTAATTTCTATGATTGGTGACAATCAAGTAGACTATCGCTTTTTTATTGGTTTTAA
ACTCTACCTCAATGAACAGGAAGTATCCGTAAAAAATGTTGGGAAAGAAATTCAAAAAGCATTTGCGGAA
TTCTTTCATGGTGTGAATCACAAATTAATGGGCGATTTTGTTTCTATGCCTATGGCGGAAATCGAACGCT
TTTCTAAGATGGAACAGTTGTTAGAAAGTAAATTATCCAGACGCTTTCAGATTCGTAAATTGGAGAAAGA
TGATTTTGGTTATATTATTGAACATCTTTACGGGCAAACAGGTGTCCCTTTTGATGACTACGACTACCAT
TTACCGAAACGATACGAAGATAAAAAAGTGTTGGTAAAGAAATACGATATTCTCAAACCCACTCGCTGTT
TAATCGAAGAAAATCAACGCTATTTACGGATTGAACAGGAAGATACCACTACTTATGTGGCGTATTTTAC
AATTAATAGTATTGTTGGTGAATTGGATTTCCCTAATAGTGAAATTTTTTATTACCAGCAACAGCAGTTT
ACTTTCCCCGTTGATACCAGTATGAATGTTGAAATTGTCGCCAATAAAAAAGCCTTATCTACCGTTCGCA
ATAAAAAGAAAGAACTGAAAGATTTAGATAGCCACGCATGGGAAAGCGACAACGAAACCAGTACTAATGT
GGTGGACGCTTTAGAATCTGTCGATGAATTAGAAAGTAATTTAGACCAAACCAAAGAATCTATGTACAAA
CTAAGCTATGTGGTACGGGTATCAGCAAAGAATTTGGACGAGCTGAAACAACGTTGTGATGAAGTAAAAG
ATTTTTATGATGATCTGTCTATCAAATTAGTACGACCTTTTGGCGATATGCTAGGCTTGCATAATGAATT
TATTCCCTCAAGCAAGCGATATATCAATGACTATATTCAATATGTCACGTCGGATTTTTTGGCTGGTCTT
GGTTTCGGTGCTACACAAATGATTGGTGAAAATTCTGGTATTTACGTCGGTTACAATCTCGATACAGGCA
GAAATATTTATCTCCAACCTAGCCTTGCAAGTCAAGGAATTAAAGGCTCTGTAACAAATGCATTAGCGTC
CGCTTTTATTGGTTCATTAGGTGGCGGAAAATCATTCTCTAACAATATGCTGGTCTATTATTCAGTACTC
TTTGGCGGACAGGCAACCATTGTTGACCCAAAAGCTGAACGTGGTGAATGGAAAGAAACCTTACCTGATA
TTGCCCATGAAATCAATATTGTTAATCTCACGAGTGAGAACGACAATAAAGGGTTACTTGACCCTTATGT
GATTTTAAAACTCCCGAAAGATTCAGAAAGCCTTGCCATTGATATTCTCACGTTCTTAACAGGTATTTCC
AGCCGAGATAGCGAGAAGTTTCCTGTCCTGCGTAAAGCTATTCGGAGTGTAACTCAAAGCAAACAACGAG
GGTTGTTATTGGTGATTGATGAATTGCGAAAAGAAGATACGCCCATCAGCAATAGTATTGCTGACCATAT
CGAAAGCTTTGTCGATTATGATTTTGCCCATCTGTTATTCAGTGATGGCAGTGTCACCCAATCCATTAGC
TTGGAAAAACAACTCAATATTATTCAAGTGGCAGATTTGGTCTTACCCGATTCCAATAGCTCTTTTGAAG
AATACACTACCATGGAATTATTAAGTGTGGCAATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTAT
CCACTCTGACCGTTCCATTTTTAAAATTGTTGACCTTGATGAGGCTTGGAGTTTTTTACAAGTGGCACAA
GGAAAAGCTCTATCTATGCGATTGGTTCGAGCAGGACGTGCCATGAATGCAGGGGTCTATTTCGTTACTC
AAAACGCGGACGATTTACTAGATGAAAAGATGAAGAATAATATTGGCTTGAAATTTGCCTTTCGTTCCAC
TGACCTAGTGGAAATCAAAAAGACCTTAGAATTTTTTGGTGTGGACAAGGAAGATGAAAACAATCAGAAA
CGCTTACGTGAATTAGAAAATGGACAATGTTTAGTTTCAGACATCTATGGTCGTGTAGGGGTTATGCAGT
TTCACCCGATTTTTGAAGAGTTGCTTCATGCCTTTGATACCAGACCGCCTGTGCGAAATGAGGTGGAAGA
ATGA
 Primer design