SecReT4
Protein ID: 157145147
T4SS name [ID]VirB [407]
Gene symbol-
Locus tagCKO_00880
StrainCitrobacter koseri ATCC BAA-895
Repliconchromosome [GenBank: NC_009792] [Browse all T4SS(s) in this replicon]
Location [Strand]870917..872671 [-]
Producthypothetical protein
Component typeVirD4
UniProt IDA8AEW7
KEGG IDcko:CKO_00880
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 3.1e-13, Aligned region: 190..231
TrwB_AAD_bind [PF10412], Evalue: 3.1e-13, Aligned region: 351..540
T4SS-DNA_transf [PF02534], Evalue: 1.6e-12, Aligned region: 343..505
AAA_10 [PF12846], Evalue: 3.9e-11, Aligned region: 195..233
AAA_10 [PF12846], Evalue: 3.9e-11, Aligned region: 381..481
DUF87 [PF01935], Evalue: 3e-09, Aligned region: 179..230
TraG-D_C [PF12696], Evalue: 7.4e-08, Aligned region: 404..496
Protein Sequence: 584 a.a.     [Download]
>gi|157145147|ref|YP_001452466.1| hypothetical protein CKO_00880 [Citrobacter koseri ATCC BAA-895]
MELANMGSHLMQRLNAFADAFSFFLLWLQNSPVILSLFAGLTLPFIVNLPREERKNAPFWLKSVACVSIF
FFIFGTISPLTIQGLSYFFKLLDNNILFRIPLWIMTVTFTTAGLFFHIAARRLLAGEIDNLKHRMIKKTK
LERNTRTDVRKVKELLPESIEYNPLDYIDLKKGAFIGLNKNDQPQYITIKEFKTQHAAIIGTTGSGKSVT
AAILLYQAILAGEAVFVEDPKDDEWAPHVLREACKKAGKKFTLINLNKPNFQLDLLADISHEQLEELFNA
GFSLAKKGEASDFYRISDRRAARNTSAIYEKGMTLYDLFNTDFVQSLRQAAPAFFGELEEVALVNSINAT
NGFSLKEVFDEGGCCYIIGSTRNQKIISAQRMILTRLIQIAETRDRINSTPRTVAIFLDELKYHLSRPAL
EGLGTARDKGVHIFMAFQAIDDLRDCPSDLNGDAVIGAIIENAKFKLIYKIQNPETAEWAAKMTGSILVD
DEMRKVRTDLSLTEKMDTDRMIRQAESYYVDSNMFLNLPEKVGFVFTTKELAKATKMSPILVKKKHIELL
SFENPQSEQPQTEINEQNKPSINL
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|157144296|ref|NC_009792.1|:c872671-870917 Citrobacter koseri ATCC BAA-895 chromosome, complete genome
ATGGAGTTAGCAAATATGGGATCACATCTTATGCAAAGGCTGAATGCTTTTGCTGACGCCTTTTCCTTTT
TCCTGTTATGGCTGCAAAACAGCCCTGTCATATTATCCCTGTTCGCAGGTCTTACATTACCGTTTATAGT
CAACCTTCCCCGAGAGGAAAGAAAGAACGCTCCGTTCTGGTTAAAATCGGTGGCGTGTGTGTCTATTTTC
TTTTTTATATTCGGTACCATATCACCGCTAACTATTCAGGGGCTGAGCTACTTTTTTAAATTACTCGACA
ACAACATACTGTTCAGAATTCCACTATGGATCATGACAGTCACATTTACGACAGCAGGATTATTCTTTCA
TATTGCAGCCCGACGACTTCTGGCGGGAGAAATTGACAACCTGAAACATCGAATGATTAAGAAAACCAAG
CTGGAGAGAAATACCAGAACGGATGTACGTAAAGTAAAAGAGCTGTTGCCCGAGAGCATAGAATACAACC
CACTCGATTACATTGATTTAAAGAAAGGTGCTTTCATTGGCTTAAACAAAAATGACCAGCCGCAATACAT
AACCATAAAAGAATTCAAGACCCAACACGCAGCAATTATCGGCACAACTGGTTCAGGGAAAAGTGTCACT
GCAGCCATTCTACTTTATCAGGCAATTCTTGCAGGCGAGGCTGTTTTTGTAGAAGATCCAAAAGATGATG
AATGGGCACCACATGTACTCAGGGAAGCATGTAAAAAAGCGGGCAAGAAATTTACACTTATAAATTTGAA
CAAGCCAAATTTTCAGCTTGATTTACTGGCTGATATCTCTCATGAACAACTGGAGGAACTATTTAACGCT
GGCTTTAGTCTGGCTAAAAAAGGGGAAGCTTCAGATTTTTATCGAATCTCTGACCGCCGCGCAGCCAGAA
ATACATCAGCAATTTATGAAAAAGGAATGACACTTTATGATTTATTTAACACTGATTTTGTTCAGTCATT
ACGTCAAGCTGCTCCCGCATTTTTTGGTGAGCTGGAAGAAGTTGCTTTAGTTAACTCAATTAATGCCACA
AATGGATTTTCATTAAAGGAGGTTTTTGATGAAGGTGGTTGTTGCTACATTATTGGTTCAACACGAAATC
AAAAAATAATATCCGCACAAAGGATGATTCTGACCCGCCTGATACAAATAGCAGAGACCAGGGACAGAAT
AAACAGCACCCCGCGTACTGTTGCTATTTTTCTCGACGAATTGAAATATCATCTATCCCGCCCCGCCCTT
GAGGGGCTTGGAACGGCACGAGATAAAGGCGTGCATATATTCATGGCTTTTCAGGCGATAGACGATCTGC
GTGACTGTCCGTCTGATTTAAATGGTGATGCAGTTATTGGAGCCATCATTGAAAACGCCAAATTCAAATT
GATTTATAAAATTCAAAATCCAGAAACAGCAGAATGGGCGGCAAAAATGACAGGTTCAATCCTGGTCGAT
GATGAAATGAGGAAAGTAAGGACTGATTTATCATTAACGGAAAAAATGGATACAGACCGTATGATAAGAC
AGGCAGAAAGTTACTACGTTGACAGTAATATGTTTTTAAATCTCCCTGAAAAGGTCGGCTTTGTATTTAC
AACAAAAGAACTGGCGAAGGCAACAAAGATGTCCCCTATTCTGGTTAAAAAGAAACATATTGAATTGCTG
TCATTTGAAAATCCTCAATCTGAACAACCACAAACCGAAATCAATGAACAAAATAAGCCATCTATTAATT
TGTAA
 Primer design