SecReT4
Protein ID: 157145153
T4SS name [ID]VirB [407]
Gene symbol-
Locus tagCKO_00886
StrainCitrobacter koseri ATCC BAA-895
Repliconchromosome [GenBank: NC_009792] [Browse all T4SS(s) in this replicon]
Location [Strand]874512..875537 [-]
Producthypothetical protein
Component typeVirB11
UniProt IDA8AEX3
KEGG IDcko:CKO_00886
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.2e-47, Aligned region: 18..279
Protein Sequence: 341 a.a.     [Download]
>gi|157145153|ref|YP_001452472.1| hypothetical protein CKO_00886 [Citrobacter koseri ATCC BAA-895]
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGMWEQHAVPLSYEDCYNFARCLAKHHGDN
IEDIKPGLSATLESGERCQVIVPPACERDTVSVTIRKPSKIQIPHQGYIDAGFYNRVTNDEKTETHDEEL
IALYNARNIPLFMEKCVEYGKTLAVAGETGSGKTTFMKMLIQYIPVHLRITTIEDNPEIIFFKHRNYVHL
FYPSESSDEKGSVVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDG
FITRCYENPQCAQLPYTFMLRKVLDSLDVIVSIDLDGDVRRMNDIYFRPAHRNQYFEEMKA
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|157144296|ref|NC_009792.1|:c875537-874512 Citrobacter koseri ATCC BAA-895 chromosome, complete genome
ATGACCGCTAAAAATATCTCCCTCGACCGCTATAAACAGCGTTTCTTTGGCGACTTTCTGGAGCTTCCCG
GCCTGACGGAAATCGCCGTCAACCGTCCAGGTGAGCTGTATACCAAAATCAACGGCATGTGGGAACAGCA
TGCCGTTCCTTTGAGCTATGAGGATTGCTACAACTTTGCCCGGTGCCTGGCAAAGCACCACGGCGACAAT
ATCGAAGATATTAAGCCGGGACTGTCAGCCACGCTGGAATCTGGCGAACGGTGCCAGGTTATTGTTCCTC
CGGCCTGTGAGCGCGATACGGTGTCTGTCACCATCCGTAAGCCCTCGAAGATACAAATCCCGCACCAGGG
ATATATCGATGCGGGATTTTATAACCGGGTAACAAACGACGAGAAGACGGAGACACACGACGAAGAATTA
ATTGCATTGTACAACGCCAGAAATATTCCTCTGTTTATGGAGAAATGCGTGGAGTATGGAAAAACATTAG
CCGTCGCAGGTGAAACTGGTTCAGGGAAAACAACATTCATGAAAATGTTGATACAGTATATCCCTGTCCA
TTTACGCATAACGACGATAGAAGACAATCCGGAGATAATATTTTTTAAACACAGGAACTACGTTCACCTG
TTTTATCCTTCTGAGTCATCCGATGAAAAAGGGTCTGTCGTTACTCCGGCGAGCCTTTTACGCTGGAATT
ACCGCATGAACCCTGACCGCATTCTGTTGACAGAAGTTCGCGGCGCGGAAGCCTGGGATTTTCTCAAAAT
TACAGGTTCCGGCCATGAAGGAAGCATGACCTCCATTCATGCCGGGTCAGCAAAAGAAGCAATAGATGGA
TTTATTACCCGTTGCTACGAGAACCCACAGTGCGCCCAGCTCCCCTATACATTTATGTTGCGTAAGGTTC
TGGACAGTCTGGACGTGATAGTGAGCATTGATTTGGACGGAGATGTCCGCCGTATGAATGACATTTATTT
CCGCCCGGCCCATCGCAATCAATATTTTGAGGAGATGAAAGCATGA
 Primer design