SecReT4
Protein ID: 157145158
T4SS name [ID]VirB [407]
Gene symbol-
Locus tagCKO_00891
StrainCitrobacter koseri ATCC BAA-895
Repliconchromosome [GenBank: NC_009792] [Browse all T4SS(s) in this replicon]
Location [Strand]878052..878735 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDA8AEX8
KEGG IDcko:CKO_00891
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4e-50, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|157145158|ref|YP_001452477.1| hypothetical protein CKO_00891 [Citrobacter koseri ATCC BAA-895]
MSEQKLIAESRTFEQQMIERDKRATKAGFVVGGMGLLIAVLALVAVVVMLPLKQTDVELYTLDNHTGRVE
HVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQVNDDYLALYAGKNAPDKVYK
NGAHTVKVEILSNQITDATAPDRVATIRYKKIIRRLADNSTRNEYWDARFTFHSNPDKEMSDAEREINYF
GFTVTSWQTDREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|157144296|ref|NC_009792.1|:c878735-878052 Citrobacter koseri ATCC BAA-895 chromosome, complete genome
ATGAGTGAACAGAAATTAATAGCTGAATCCCGCACTTTTGAGCAGCAAATGATTGAGCGGGATAAACGCG
CCACAAAAGCCGGTTTTGTTGTTGGCGGTATGGGTCTGCTGATTGCGGTACTGGCGCTCGTCGCCGTGGT
CGTGATGTTGCCGCTGAAACAGACGGACGTTGAGCTGTATACCTTGGATAACCACACAGGACGGGTGGAA
CACGTTACCCGGACATCGAAAACCAGCCTGACCGCAACAGAAGCCTATCAAAAGGCGATGGCCGCAAACT
ACGTCAAAGTGCGTGAGCGGTATGTCTATCCCTCTTTGCAGGACGACTACGAGACGGTACAAGTCTACAA
CGCTCCCCAGGTAAACGATGACTATCTGGCGCTTTACGCCGGAAAAAACGCCCCAGACAAGGTTTATAAG
AACGGGGCGCACACCGTGAAAGTGGAGATCTTGTCCAACCAGATCACCGATGCGACAGCCCCTGATAGGG
TCGCCACCATCCGCTACAAGAAGATTATCCGCCGTCTGGCTGATAACAGCACCCGCAACGAATATTGGGA
TGCCCGGTTCACGTTCCATTCTAACCCTGACAAGGAAATGAGCGATGCGGAACGCGAGATCAACTACTTC
GGCTTTACCGTCACCAGTTGGCAGACCGACCGCGAAATCCGGGGAGGTGAATGA
 Primer design