SecReT4
Protein ID: 157145159
T4SS name [ID]VirB [407]
Gene symbol-
Locus tagCKO_00892
StrainCitrobacter koseri ATCC BAA-895
Repliconchromosome [GenBank: NC_009792] [Browse all T4SS(s) in this replicon]
Location [Strand]878728..878880 [-]
Producthypothetical protein
Component typeVirB7
UniProt IDA8AEX9
KEGG IDcko:CKO_00892
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 50 a.a.     [Download]
>gi|157145159|ref|YP_001452478.1| hypothetical protein CKO_00892 [Citrobacter koseri ATCC BAA-895]
MRKSLMKRLIALALLCALSGCAQNTPPSAFSGKGEPVNTPQIMAELNSHE
 
Nucleotide Sequence: 153 bp     [Download]
>gi|157144296|ref|NC_009792.1|:c878880-878728 Citrobacter koseri ATCC BAA-895 chromosome, complete genome
TTGAGGAAATCATTGATGAAACGCTTGATTGCGCTGGCTTTGCTGTGCGCGCTTTCTGGCTGCGCCCAGA
ACACGCCTCCCTCTGCCTTTAGCGGTAAGGGAGAACCCGTAAACACCCCTCAAATTATGGCGGAGTTAAA
CAGTCATGAGTGA
 Primer design