SecReT4
Protein ID: 157145160
T4SS name [ID]VirB [407]
Gene symbol-
Locus tagCKO_00893
StrainCitrobacter koseri ATCC BAA-895
Repliconchromosome [GenBank: NC_009792] [Browse all T4SS(s) in this replicon]
Location [Strand]878957..880030 [-]
Producthypothetical protein
Component typeVirB6
UniProt IDA8AEY0
KEGG IDcko:CKO_00893
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1e-46, Aligned region: 40..259
Protein Sequence: 357 a.a.     [Download]
>gi|157145160|ref|YP_001452479.1| hypothetical protein CKO_00893 [Citrobacter koseri ATCC BAA-895]
MSGGLFVGVEKYLIGGITDATKGLMMSYSSMMMGLAAASATIYIMWRGYQTLAGKLSTPMEDTMWDIMRM
AIILSFVANLGGYLDGVIDAINGIKEGFSGSDNIWQLLDTLWNKAKVLGKTLHDMDNSTYVKDEGMTAQF
CVWLGIFALMILAGFVSMVAEVMILLLGITAPIFIFCLMYGFLRPMFNNWLQNIFAGILTILFAALSLRI
VVNYLNLVLNKATKVADSSTIVELGAQVCLAGIFAAILVYISAKVAAALAGASATVSMQGLAAVGIGAAA
FGAGKLAGGAVKETKRSAQDNIQGWKDANAGKPGKPGGELGYNASKARKYAIEQMIARNEARRLAQSRES
AVKKFNS
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|157144296|ref|NC_009792.1|:c880030-878957 Citrobacter koseri ATCC BAA-895 chromosome, complete genome
ATGAGTGGCGGTCTTTTTGTTGGGGTTGAAAAATACCTGATAGGAGGAATTACAGACGCCACAAAGGGAT
TGATGATGTCGTACTCTTCTATGATGATGGGGCTGGCAGCAGCGTCAGCTACCATCTACATCATGTGGCG
TGGATACCAGACTTTGGCTGGTAAGCTATCTACGCCTATGGAAGACACGATGTGGGACATCATGAGGATG
GCGATCATCCTGTCCTTTGTGGCTAATTTAGGCGGCTACCTCGATGGCGTTATTGATGCCATAAACGGAA
TAAAGGAGGGTTTTTCTGGTAGTGATAATATATGGCAGTTATTAGACACCCTATGGAATAAGGCTAAAGT
GTTAGGGAAAACGCTACATGACATGGATAATTCTACATATGTAAAAGATGAGGGAATGACTGCTCAATTT
TGTGTATGGCTTGGAATATTCGCACTTATGATTCTAGCGGGCTTTGTTTCAATGGTTGCCGAAGTAATGA
TTCTACTATTAGGAATAACTGCACCTATTTTCATATTCTGCCTTATGTATGGTTTCCTCCGCCCCATGTT
CAATAACTGGTTGCAAAATATATTTGCAGGAATATTAACAATTCTATTTGCCGCTCTCTCATTGAGAATT
GTAGTGAATTACTTGAATCTCGTTCTTAATAAGGCGACGAAGGTAGCAGACAGTTCAACAATTGTTGAAC
TTGGTGCTCAAGTCTGCCTTGCAGGTATTTTCGCTGCAATACTGGTGTATATTTCCGCTAAGGTAGCCGC
AGCTCTGGCCGGGGCAAGCGCTACCGTATCCATGCAGGGGCTGGCCGCTGTAGGTATCGGTGCGGCTGCT
TTTGGTGCCGGGAAGCTAGCCGGGGGTGCAGTTAAAGAAACCAAACGTTCCGCCCAGGACAACATTCAGG
GCTGGAAGGATGCGAATGCAGGTAAGCCCGGCAAGCCCGGAGGTGAGTTAGGCTATAACGCATCTAAAGC
GCGGAAGTACGCGATTGAGCAGATGATAGCCCGGAACGAAGCGCGGAGGCTGGCACAGTCGAGAGAATCC
GCGGTTAAGAAGTTCAACAGCTAG
 Primer design