SecReT4
Protein ID: 157145163
T4SS name [ID]VirB [407]
Gene symbol-
Locus tagCKO_00896
StrainCitrobacter koseri ATCC BAA-895
Repliconchromosome [GenBank: NC_009792] [Browse all T4SS(s) in this replicon]
Location [Strand]881009..883747 [-]
Producthypothetical protein
Component typeVirB4
UniProt IDA8AEY3
KEGG IDcko:CKO_00896
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.6e-47, Aligned region: 269..470
AAA_10 [PF12846], Evalue: 1.4e-24, Aligned region: 533..823
VirB3 [PF05101], Evalue: 2.1e-08, Aligned region: 4..81
Protein Sequence: 912 a.a.     [Download]
>gi|157145163|ref|YP_001452482.1| hypothetical protein CKO_00896 [Citrobacter koseri ATCC BAA-895]
MAKLLKAMKRPAALWGVPMVPLLAVTGVTIIVAIWTSVALLFLLPVQFLVMKSLTRNEPMRFNLIAVWLR
AKGKPVANRLFGATTFMPVEHDDVDIKEFLDAMKLNQCATIKKYIPYSSHIHQHVVRSPKSDLYCTWELM
GTPFDCESDESLQFGTNQLHGLIRSFEGMPVTFYIHNDRNTFTDNLHKDSGNPYADEVSRLYYASVGLFR
RNRLFLTVCYRPFVSLEKAERKRMKDSQKLKELDGALLEMLEIKSTLDTALSRYGARPLGTFTEGNAVFS
SQLAFYEYLLTHQWRKVRVTRTPAYDVMGAAALFFSAESGQINHANGTQYFRGLEVKEFSEETATGMMDS
LLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSADDDAVSQRLDLDVALDLLTSGKIAYGKHHFSIMV
YSPSLESLVADTNEISNALNNIGITPVPAEISLSAAYMAQLPGNYNLRPRKGELSSQNFVELAALHNFYP
GKRDKAPWGDAMALLRTPSGDGYYINLHNTLADKDEFNEKNPASTCILGTNGSGKTMLMTFFEIMQQKYG
REDSFSPDAKTKRLTTVYLDKDRGAEMNIRALGGRYYRVISGESTGWNPFSLPATKRNINFIKQLMKILC
TRNGSTISPRDERRLSDAVNAVMNDEPQYRVYGITRMLENLPEPATKEAQENGLSIRLSQWAQGGEFGWV
FDNESDTFDISNCDNFGIDGTEFLDDASVCAPISFYLLYRITSLLDGRRLVIFMDEFWKWLRDPVFKDFA
YNKLKTIRKLNGMLVVGTQSPAEIIKDDIAPAVIEQCGTQILAANPNADRAHYVDGMKFEPEVFDVVKGL
DPQARQYVVVKNQFKRGDTKRFAARVTLDLSGIGRYTKVMSGDAPNLEIFESIYREGMQPHEWLDTYLAK
AL
 
Nucleotide Sequence: 2739 bp     [Download]
>gi|157144296|ref|NC_009792.1|:c883747-881009 Citrobacter koseri ATCC BAA-895 chromosome, complete genome
ATGGCAAAGCTGCTCAAGGCAATGAAACGCCCGGCGGCGCTGTGGGGGGTGCCAATGGTGCCCCTGCTGG
CTGTCACGGGTGTAACCATCATCGTTGCTATCTGGACTTCCGTCGCTCTCCTGTTCTTACTTCCTGTGCA
ATTTCTGGTGATGAAGTCCCTTACCAGAAATGAACCGATGCGGTTCAATCTGATTGCCGTATGGCTGAGA
GCGAAGGGAAAGCCGGTAGCAAACCGTTTATTTGGCGCAACAACATTTATGCCCGTTGAGCATGATGATG
TTGATATCAAGGAGTTTCTCGACGCCATGAAACTAAATCAGTGTGCCACCATCAAGAAGTACATCCCGTA
CTCATCGCACATTCATCAGCATGTGGTTCGTTCCCCTAAGAGCGATCTGTACTGCACCTGGGAATTGATG
GGAACGCCGTTCGACTGCGAGTCTGACGAGTCGCTCCAGTTCGGGACGAACCAGTTACACGGGCTAATCC
GCTCATTCGAAGGTATGCCAGTTACTTTCTATATCCATAACGACCGCAATACGTTTACCGACAATCTTCA
TAAAGATTCCGGCAACCCGTATGCCGATGAAGTTAGCCGTCTTTACTACGCTTCTGTCGGTCTGTTCCGG
CGCAACCGCCTGTTCCTGACGGTCTGCTATCGCCCGTTTGTCAGCCTTGAAAAAGCAGAACGCAAACGGA
TGAAAGACAGCCAGAAACTAAAGGAGCTGGACGGTGCTTTGCTGGAAATGCTGGAAATAAAAAGCACGCT
CGATACCGCGCTGTCGCGCTATGGTGCGCGACCTCTCGGTACGTTTACCGAAGGAAACGCGGTGTTTTCG
TCGCAACTGGCTTTCTATGAATATCTGCTAACGCACCAGTGGCGAAAAGTGCGCGTCACCCGTACCCCGG
CCTATGACGTGATGGGGGCGGCGGCGTTGTTCTTTTCGGCTGAATCCGGGCAGATAAACCACGCCAACGG
TACGCAATATTTCCGGGGGCTGGAGGTTAAAGAGTTCTCCGAAGAGACCGCCACGGGGATGATGGACTCC
CTTCTTTACGCCCCCTGCGATTACGTGATCACGCAGTCCTATACCTGCATGTCACGCGAGGAAGCGAAGA
AAGCCATTAAGCGTACCCGTCGCCTTTTGATGAGTGCCGACGACGATGCTGTTTCCCAGCGGCTGGATCT
GGATGTGGCGCTTGACCTGCTGACATCGGGGAAAATCGCTTACGGCAAGCACCATTTTTCCATCATGGTG
TATTCCCCGTCGCTGGAAAGCCTGGTTGCTGATACGAATGAAATCAGTAACGCGCTGAACAACATAGGGA
TAACGCCTGTTCCGGCAGAAATATCGCTTTCAGCGGCGTATATGGCGCAACTGCCAGGCAACTACAACCT
GAGGCCACGTAAAGGGGAGCTGAGTAGCCAGAACTTTGTGGAGCTGGCCGCGCTCCATAATTTCTATCCG
GGCAAGCGCGATAAAGCCCCCTGGGGGGATGCGATGGCTTTACTGCGCACCCCGTCAGGCGATGGCTACT
ATATCAACCTGCATAACACACTGGCAGATAAGGACGAATTCAACGAGAAGAACCCGGCCAGTACCTGCAT
CCTCGGTACGAACGGTTCGGGTAAAACCATGTTGATGACGTTCTTTGAGATCATGCAGCAGAAATACGGG
CGCGAGGATAGCTTCTCCCCGGATGCCAAAACCAAACGGCTGACAACCGTTTACCTCGATAAAGACCGGG
GCGCAGAGATGAACATCCGGGCGCTGGGTGGCCGTTACTATCGGGTTATCAGTGGTGAGTCTACAGGGTG
GAACCCGTTCTCGTTGCCAGCAACCAAACGCAATATCAATTTCATCAAGCAACTGATGAAAATCCTTTGT
ACCCGTAACGGCTCGACGATCTCCCCACGCGATGAACGACGTCTGAGTGATGCGGTCAATGCTGTGATGA
ATGACGAGCCGCAATATCGCGTCTACGGCATTACCCGAATGCTGGAAAATTTGCCTGAGCCGGCTACGAA
AGAAGCCCAGGAAAACGGCCTTAGCATTCGGTTGTCACAGTGGGCGCAGGGCGGTGAGTTCGGCTGGGTG
TTTGATAACGAGTCTGACACGTTCGATATCAGCAACTGCGATAACTTCGGCATCGACGGAACGGAGTTCC
TGGACGATGCAAGCGTATGTGCGCCAATCTCGTTTTATCTGCTGTACCGCATTACCAGCCTGCTTGACGG
GCGACGCCTGGTCATTTTCATGGATGAATTCTGGAAGTGGTTACGCGACCCGGTGTTTAAGGACTTTGCT
TATAACAAGCTGAAAACCATCCGTAAGCTGAACGGGATGCTGGTCGTCGGTACTCAATCCCCGGCAGAGA
TCATCAAAGATGATATCGCCCCGGCAGTGATTGAGCAGTGCGGGACACAGATTCTGGCGGCGAACCCCAA
CGCCGACCGCGCACACTATGTTGACGGTATGAAGTTTGAACCGGAAGTGTTCGACGTGGTGAAAGGGCTT
GACCCGCAAGCCCGCCAGTATGTTGTGGTGAAAAATCAGTTCAAGCGCGGCGATACCAAACGTTTTGCCG
CTCGTGTCACGCTCGACCTGTCGGGTATCGGCAGATACACCAAAGTCATGAGCGGCGATGCCCCCAACCT
CGAAATATTCGAATCGATTTACCGGGAAGGAATGCAGCCTCATGAATGGCTCGATACCTACCTGGCTAAA
GCGCTCTGA
 Primer design