SecReT4
Protein ID: 157145165
T4SS name [ID]VirB [407]
Gene symbol-
Locus tagCKO_00898
StrainCitrobacter koseri ATCC BAA-895
Repliconchromosome [GenBank: NC_009792] [Browse all T4SS(s) in this replicon]
Location [Strand]884053..884763 [-]
Producthypothetical protein
Component typeVirB1
UniProt IDA8AEY5
KEGG IDcko:CKO_00898
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 7.3e-21, Aligned region: 9..142
Protein Sequence: 236 a.a.     [Download]
>gi|157145165|ref|YP_001452484.1| hypothetical protein CKO_00898 [Citrobacter koseri ATCC BAA-895]
MLSTTAFLAIAMQCAASIHPSTAFDVARVESGFNPYAIAEIVPKAGPSFGDQHIISHLPASRGDAEHILR
RLSAQDRRYSVGLMQITSTNFRHYGVSATELLDPCTNLSVFEHILRDCYRRGGTLKRALSCYYSGNFSTG
QQPETAFSGTSYIQRIGYPPGSSRYAVPGTREDKSSVAVPLKTAPASDSSRHHVIWPGVVVRGVPAKLRQ
EKIFIAPFSAPSVRRSFSLSPREEEE
 
Nucleotide Sequence: 711 bp     [Download]
>gi|157144296|ref|NC_009792.1|:c884763-884053 Citrobacter koseri ATCC BAA-895 chromosome, complete genome
ATGCTTTCCACCACAGCCTTTCTGGCGATAGCCATGCAGTGCGCCGCCAGCATTCATCCGTCCACGGCAT
TCGACGTGGCACGGGTGGAATCCGGTTTTAACCCTTATGCCATCGCTGAGATTGTCCCGAAGGCCGGCCC
CTCTTTCGGCGATCAACACATTATTTCTCACCTGCCAGCCAGCCGGGGAGATGCAGAGCATATTCTCCGT
CGCCTGTCAGCACAGGATCGCCGTTACTCTGTCGGGCTGATGCAAATCACCAGCACCAATTTCCGCCATT
ATGGTGTGTCCGCCACAGAGCTACTTGATCCCTGTACCAATCTGTCCGTCTTCGAACACATTCTCAGAGA
CTGCTACCGGCGCGGCGGCACGCTGAAAAGGGCGCTGAGTTGTTATTATTCCGGCAATTTCAGTACCGGG
CAACAACCTGAAACGGCGTTTTCCGGAACGAGCTATATCCAGCGAATCGGTTATCCGCCGGGATCATCCC
GCTATGCGGTCCCCGGAACCCGTGAGGACAAATCATCAGTTGCCGTTCCCCTGAAAACCGCCCCTGCCAG
TGACTCATCCCGTCACCACGTGATCTGGCCCGGAGTCGTCGTCCGTGGCGTCCCTGCGAAACTCCGCCAA
GAAAAAATCTTCATCGCACCGTTCTCCGCGCCGTCAGTGCGCCGGAGTTTCTCCCTGTCACCCCGTGAGG
AGGAGGAATAA
 Primer design