SecReT4
Protein ID: 157368572
T4SS name [ID]Tfc [690]
Gene symbol-
Locus tagSpro_0323
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]375841..376533 [+]
Productlytic transglycosylase
Component typeTfc4
UniProt IDA8G8J3
KEGG IDspe:Spro_0323
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 230 a.a.     [Download]
>gi|157368572|ref|YP_001476561.1| lytic transglycosylase [Serratia proteamaculans 568]
MDTRRVLTRGLLPLLAFLTSVGGGAVHAATQQVPSGYREVALRHGVPPESLYSVALAETSMAPKSIVSVT
RGAGPAPDVERPWPWTINVAGKGYRYASRLQAWEALQRFLKTHPRKRIDVGIAQVNLGWNGHHFTSTWAA
FDPYTNLNAAAAILRECYDRNPGSWLTAAGCYHHPAGGAPAARYKSIVSGKLARLNGRASDLPRVASTTP
TATTLPAQTAALTWIEPRSQ
 
Nucleotide Sequence: 693 bp     [Download]
>ref|NC_009832.1|:375841-376533 lytic transglycosylase [Serratia proteamaculans 568]
ATGGACACTCGCCGCGTTCTGACCCGGGGGCTATTGCCCCTGCTTGCCTTCCTCACTTCTGTGGGGGGCG
GAGCCGTTCATGCTGCTACCCAGCAGGTCCCTTCCGGTTATCGGGAGGTGGCGTTGCGTCATGGGGTTCC
TCCGGAGTCCCTGTATTCGGTGGCGTTGGCCGAGACATCGATGGCGCCGAAAAGCATCGTCTCGGTGACC
CGCGGCGCCGGTCCGGCTCCGGATGTGGAGCGCCCCTGGCCCTGGACCATCAATGTTGCGGGTAAAGGGT
ATCGCTATGCCAGCCGACTGCAGGCGTGGGAAGCCTTGCAGCGTTTTTTGAAAACACATCCTCGCAAGCG
CATCGATGTCGGAATTGCCCAGGTCAATCTGGGCTGGAACGGCCATCACTTTACGTCGACCTGGGCGGCG
TTTGATCCGTACACCAATCTCAACGCGGCGGCGGCCATCCTGCGGGAATGCTATGACCGCAATCCTGGGA
GTTGGCTGACCGCAGCCGGCTGCTATCACCACCCTGCCGGCGGTGCGCCCGCTGCCCGGTATAAATCTAT
TGTGAGTGGCAAGCTGGCACGCCTAAACGGCAGGGCGTCTGACCTGCCCCGGGTGGCCAGTACAACCCCC
ACGGCCACGACATTACCGGCACAAACGGCCGCACTGACCTGGATTGAACCACGGAGCCAATAA
 Primer design