SecReT4
Protein ID: 157368576
T4SS name [ID]Tfc [690]
Gene symbol-
Locus tagSpro_0327
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]379739..380497 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA8G8J7
KEGG IDspe:Spro_0327
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 4.1e-75, Aligned region: 49..249
Protein Sequence: 252 a.a.     [Download]
>gi|157368576|ref|YP_001476565.1| hypothetical protein Spro_0327 [Serratia proteamaculans 568]
MSQAVNNQPQQPVQPRKHGLFYNVLWGWPWMLIGMFFASLLVSLVIEYVGMAFFWPELGASHSEAVMHTE
MGYLSSEFTRSLMLSEPSVTVTRWIGQAYQWTFVDSGFLDWIQRAYDSQVHSQNAVARELNSWSGWLAAT
LKEYLVATVYVTVITLVRVTILVLSIPLFILVVLVALTEGLGRRDIRRYGAGYESSFVYHHAKRMVKPAI
YIPCMLYLSWPTAVYPNLLLLPAAILLGIAVTVTTASFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>ref|NC_009832.1|:379739-380497 hypothetical protein Spro_0327 [Serratia proteamaculans 568]
ATGTCACAAGCGGTGAATAATCAGCCTCAGCAGCCCGTACAACCTCGCAAGCATGGGTTGTTTTACAACG
TACTGTGGGGCTGGCCATGGATGCTGATCGGGATGTTCTTCGCCTCGTTGTTAGTGAGCCTGGTGATTGA
GTATGTCGGGATGGCATTCTTCTGGCCAGAGCTTGGCGCGTCGCACAGTGAAGCGGTGATGCATACCGAA
ATGGGGTATTTGTCATCGGAGTTTACCCGCAGTCTGATGTTGTCTGAGCCGTCAGTCACCGTCACGCGGT
GGATTGGCCAGGCGTATCAGTGGACCTTCGTGGACAGCGGTTTTTTGGACTGGATCCAACGTGCCTATGA
TTCGCAGGTGCACAGCCAGAATGCGGTGGCCCGAGAGCTGAACAGTTGGAGTGGCTGGCTGGCCGCCACG
CTCAAAGAGTACCTGGTGGCAACAGTGTATGTCACCGTCATCACCCTGGTGCGGGTGACCATTCTTGTGC
TGTCCATCCCGCTGTTTATCCTGGTGGTCCTGGTTGCGCTGACAGAAGGCCTGGGGCGGCGTGATATCCG
TCGTTATGGTGCCGGCTATGAAAGCAGCTTTGTCTACCATCATGCGAAACGAATGGTAAAGCCGGCTATT
TATATTCCCTGCATGCTGTATCTGTCCTGGCCAACTGCGGTATATCCCAATCTGCTGTTGTTGCCAGCCG
CTATCCTGCTCGGTATTGCGGTGACAGTGACGACAGCGTCATTTAAGAAATATTTGTAG
 Primer design