SecReT4
Protein ID: 157368578
T4SS name [ID]Tfc [690]
Gene symbol-
Locus tagSpro_0329
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]381523..381855 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA8G8J9
KEGG IDspe:Spro_0329
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.7e-30, Aligned region: 24..105
Protein Sequence: 110 a.a.     [Download]
>gi|157368578|ref|YP_001476567.1| hypothetical protein Spro_0329 [Serratia proteamaculans 568]
MRIPVVTRGLGAGFLLGLSFLIALPALAAEKDELASAQRMLVQVQAALERARVAAVQADPSERGRFFFDY
ARATADLKTINAGIDRYLEPSRAQPRDGSAVAGNYHRERP
 
Nucleotide Sequence: 333 bp     [Download]
>ref|NC_009832.1|:381523-381855 hypothetical protein Spro_0329 [Serratia proteamaculans 568]
ATGCGTATCCCCGTAGTTACCCGAGGACTGGGCGCCGGCTTTTTGCTGGGGCTGTCATTCCTCATCGCAC
TGCCTGCCCTGGCTGCTGAAAAAGATGAGCTGGCATCTGCCCAGCGCATGCTGGTTCAGGTGCAGGCGGC
GCTTGAACGCGCGCGCGTTGCCGCCGTTCAGGCCGACCCGTCCGAGCGTGGCCGTTTCTTCTTTGACTAT
GCCCGCGCCACTGCCGACCTCAAGACAATCAATGCCGGTATTGACCGTTACCTCGAACCCTCGCGCGCGC
AACCGCGTGATGGCAGCGCGGTGGCCGGTAATTACCACCGGGAGCGTCCCTGA
 Primer design