SecReT4
Protein ID: 157368581
T4SS name [ID]Tfc [690]
Gene symbol-
Locus tagSpro_0332
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T4SS(s) in this replicon]
Location [Strand]382530..382895 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA8G8K2
KEGG IDspe:Spro_0332
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 9.7e-44, Aligned region: 1..117
Protein Sequence: 121 a.a.     [Download]
>gi|157368581|ref|YP_001476570.1| hypothetical protein Spro_0332 [Serratia proteamaculans 568]
MQTIRFLPDRLNAEPVVFRGFTTPEMGLAALAGVGLGLLVSLPFFPLAGWVVIPTGMLVTPLLVIWFGGS
RLTRIKRGKPENYIWQRLEARKRRIGWGNPTLIIDKQGWSLRRSRVVKRSK
 
Nucleotide Sequence: 366 bp     [Download]
>ref|NC_009832.1|:382530-382895 hypothetical protein Spro_0332 [Serratia proteamaculans 568]
ATGCAGACTATCCGATTTTTGCCTGACCGCCTCAACGCTGAGCCTGTCGTCTTCCGGGGCTTTACCACCC
CGGAGATGGGACTGGCGGCGTTGGCCGGTGTGGGACTGGGTCTGCTCGTGTCGTTGCCGTTTTTTCCGCT
TGCCGGTTGGGTCGTGATACCCACCGGCATGCTGGTGACCCCTCTCCTCGTTATCTGGTTTGGTGGCAGC
CGACTGACGCGCATCAAGCGCGGTAAACCGGAGAATTATATCTGGCAGCGCCTCGAGGCACGTAAACGTC
GCATAGGGTGGGGAAATCCCACCCTGATTATCGACAAACAGGGCTGGTCGTTGCGTCGCAGCCGCGTTGT
TAAGAGGTCCAAATGA
 Primer design